Copy Link Print Information

IL-36 gamma/IL-1F9 Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 gamma/IL-1F9 Protein, Mouse is a recombinant mouse IL-36 gamma (G13-S164) without any tag, which is produced in E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-36 gamma/IL-1F9 Protein, Mouse
  • Experimental Validation Results for IL-36 gamma/IL-1F9 Protein, Mouse
  • IL-36 gamma/IL-1F9 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 gamma/IL-1F9 Protein, Mouse is a recombinant mouse IL-36 gamma (G13-S164) without any tag, which is produced in E. coli.

Background

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma is expressed in peripheral blood lymphocytes, keratinocytes, bronchial epithelial cells and THP-1 cells[3].
The sequence of amino acids in IL-36 gamma differs in different species. Human IL-36 gamma shares <55% aa sequence identity with mouse.
IL-36 gamma has β-trefoil structure. L-36 gamma binds to IL-36R and recruits the co-receptor IL-1RAcP. So that heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways[1]. But the activation requires N-terminal cleavage at Val1518 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[1][2]. IL-36 gamma is an effective type I and IL-17-mediated immunity against bacterial lung infection[4]. IL-36 gamma also mediates immune protection during influenza infection in mice[5].
IL-36 gamma is a pro-inflammatory factor. IL-36 gamma mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[2].

In Vitro

IL-36 gamma (mouse, 0-50 ng/mL, 36 h) increases IL-12p40, IL-23p19, and TNF-α mRNA in BMDCs[6].
IL-36 gamma (mouse, 100 ng/mL, 24 h) induces COX-2 expression and the production of PGE2 in pulmonary macrophages (PMs) isolated from WT mice[7].

In Vivo

IL-36 gamma (mouse, 100 ng, 250 ng, or 500 ng in 10 µL, i.vag. instillation) limits HSV-2 viral replication, and protects against lethal HSV-2 challenge in mice[8].

Verified Bioactivity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤11.16 ng/mL. Corresponding to a specific activity is 8.961×104 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q8R460 (G13-S164)

  • Gene ID
    215257  [NCBI]
  • Molecular Construction
    • N-term
    • IL-36γ (G13-S164)
      Accession # Q8R460
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL36G; Interleukin 1-Related Protein 2; Prev. IL1F9; Interleukin-36 Gamma; IL-1RP2; IL1RP2; IL-1F9; Interleukin 1 Family, Member 9; IL-1H1; IL-1 Related Protein 2; IL1H1; IL-1-Related Protein 2; IL1E; IL-1-Epsilon; Interleukin-1 Homolog 1; IL-1 Epsilon; I

  • AA Sequence

    GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

  • Predicted Molecular Mass

    17.3 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 10 mM TCEP, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281(1):169-178. [Content Brief]

[2]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210. [Content Brief]

[3]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65. [Content Brief]

[4]. Melissa A. Kovach, et al. IL-36γ is a Potent Inducer of Type I and IL-17 Cytokine Induction During Lung Infection. American Journal of Respiratory and Critical Care Medicine, 2015, 191: 1.

[5]. Wein AN, et al. IL-36γ Protects against Severe Influenza Infection by Promoting Lung Alveolar Macrophage Survival and Limiting Viral Replication. J Immunol. 2018 Jul 15;201(2):573-582. [Content Brief]

[6]. Kovach MA, et al. IL-36γ is a crucial proximal component of protective type-1-mediated lung mucosal immunity in Gram-positive and -negative bacterial pneumonia. Mucosal Immunol. 2017 Sep;10(5):1320-1334. [Content Brief]

[7]. Aoyagi T, et al. Interleukin-36γ and IL-36 receptor signaling mediate impaired host immunity and lung injury in cytotoxic Pseudomonas aeruginosa pulmonary infection: Role of prostaglandin E2. PLoS Pathog. 2017 Nov 22;13(11):e1006737. [Content Brief]

[8]. Gardner JK, Herbst-Kralovetz MM. IL-36γ induces a transient HSV-2 resistant environment that protects against genital disease and pathogenesis. Cytokine. 2018 Nov;111:63-71. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 8.072 ng/mL. Corresponding to a specific activity is 1.239×105 U/mg.

  • IL-36 gamma/IL-1F9 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IL-36 gamma/IL-1F9 Protein, Mouse
  • Experimental Validation Results for IL-36 gamma/IL-1F9 Protein, Mouse
  • IL-36 gamma/IL-1F9 Protein, Mouse Product Image