IL-36 gamma/IL-1F9 Protein, Mouse

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases^[1][2]. IL-36 gamma/IL-1F9 Protein, Mouse is a recombinant mouse IL-36 gamma (G13-S164) without any tag, which is produced in E. coli.

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma is expressed in peripheral blood lymphocytes, keratinocytes, bronchial epithelial cells and THP-1 cells^[3].
The sequence of amino acids in IL-36 gamma differs in different species. Human IL-36 gamma shares <55% aa sequence identity with mouse.
IL-36 gamma has β-trefoil structure. L-36 gamma binds to IL-36R and recruits the co-receptor IL-1RAcP. So that heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways^[1]. But the activation requires N-terminal cleavage at Val15¹⁸ by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3^[1][2]. IL-36 gamma is an effective type I and IL-17-mediated immunity against bacterial lung infection^[4]. IL-36 gamma also mediates immune protection during influenza infection in mice^[5].
IL-36 gamma is a pro-inflammatory factor. IL-36 gamma mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway^[2].

IL-36 gamma (mouse, 0-50 ng/mL, 36 h) increases IL-12p40, IL-23p19, and TNF-α mRNA in BMDCs^[6].
IL-36 gamma (mouse, 100 ng/mL, 24 h) induces COX-2 expression and the production of PGE2 in pulmonary macrophages (PMs) isolated from WT mice^[7].

IL-36 gamma (mouse, 100 ng, 250 ng, or 500 ng in 10 µL, i.vag. instillation) limits HSV-2 viral replication, and protects against lethal HSV-2 challenge in mice^[8].

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is ≤11.16 ng/mL. Corresponding to a specific activity is 8.961×10⁴ U/mg.

• 
  Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 8.072 ng/mL. Corresponding to a specific activity is 1.239×10⁵ U/mg.

Mouse

E. coli

Tag Free

Q8R460 (G13-S164)

215257  [NCBI]

Full Length of Mature Protein

GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 10 mM TCEP, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hl-60-cell.html  [Content Brief]

  [2]. Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281(1):169-178.  [Content Brief]

  [3]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.  [Content Brief]

  [4]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65.  [Content Brief]

  [5]. Melissa A. Kovach, et al. IL-36γ is a Potent Inducer of Type I and IL-17 Cytokine Induction During Lung Infection. American Journal of Respiratory and Critical Care Medicine, 2015, 191: 1.

  [6]. Wein AN, et al. IL-36γ Protects against Severe Influenza Infection by Promoting Lung Alveolar Macrophage Survival and Limiting Viral Replication. J Immunol. 2018 Jul 15;201(2):573-582.  [Content Brief]

  [7]. Kovach MA, et al. IL-36γ is a crucial proximal component of protective type-1-mediated lung mucosal immunity in Gram-positive and -negative bacterial pneumonia. Mucosal Immunol. 2017 Sep;10(5):1320-1334.  [Content Brief]

  [8]. Aoyagi T, et al. Interleukin-36γ and IL-36 receptor signaling mediate impaired host immunity and lung injury in cytotoxic Pseudomonas aeruginosa pulmonary infection: Role of prostaglandin E2. PLoS Pathog. 2017 Nov 22;13(11):e1006737.  [Content Brief]

  [9]. Gardner JK, Herbst-Kralovetz MM. IL-36γ induces a transient HSV-2 resistant environment that protects against genital disease and pathogenesis. Cytokine. 2018 Nov;111:63-71.  [Content Brief]