IL-36RN Protein, Mouse

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.

Background

IL-36RN protein is predicted to possess several important functional attributes, including cytokine activity, interleukin-1 receptor antagonist activity, and interleukin-1 receptor binding activity. It plays a role upstream of or within the negative regulation of interleukin-6 production. The protein is predicted to be located in both the cytoplasm and extracellular region, suggesting its potential involvement in diverse cellular processes. Furthermore, IL-36RN is anticipated to be active in the extracellular space. In humans, this gene is associated with pustular psoriasis 14, indicating its relevance in skin pathology. Notably, IL-36RN shares orthology with the human interleukin 36 receptor antagonist (IL36RN). Expression analysis reveals biased expression in the adult stomach (RPKM 9.0) and lung (RPKM 1.0), underscoring its potential significance in these tissues.

Verified Bioactivity

Measured by its ability to inhibit IL-36 beta induced IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.7930-0.8070 μg/mL, corresponding to a specific activity is 1239.1574-1261.034 U/mg, in the presence of 15 ng/mL of Recombinant Mouse IL-36 beta/IL-1F8.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit IL-36 beta induced IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50for this effect is 0.8070 μg/mL, corresponding to a specific activity is 1239.1574 U/mg, in the presence of 15 ng/mL of Recombinant Mouse IL-36 beta.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-36RN (V3-D156)
      Accession # NP_062324.2
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL36RN; IL-1ra Homolog 1; Prev. IL1F5; IL-36Ra; IL1HY1; IL-1F5 (IL-1HY1, FIL1-Delta, IL-1RP3, IL-1L1, IL-1-Delta); IL1RP3; IL1F5 (Canonical Product IL-1F5a); FIL1D; Family Of Interleukin 1-Delta; IL1L1; Interleukin-1 Family Member 5; Interleukin-1 Recepto

  • AA Sequence

    VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00