IL-36RN Protein, Mouse
Based on 2 publication(s) in Google Scholar
IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.
IL-36RN protein is predicted to possess several important functional attributes, including cytokine activity, interleukin-1 receptor antagonist activity, and interleukin-1 receptor binding activity. It plays a role upstream of or within the negative regulation of interleukin-6 production. The protein is predicted to be located in both the cytoplasm and extracellular region, suggesting its potential involvement in diverse cellular processes. Furthermore, IL-36RN is anticipated to be active in the extracellular space. In humans, this gene is associated with pustular psoriasis 14, indicating its relevance in skin pathology. Notably, IL-36RN shares orthology with the human interleukin 36 receptor antagonist (IL36RN). Expression analysis reveals biased expression in the adult stomach (RPKM 9.0) and lung (RPKM 1.0), underscoring its potential significance in these tissues.
Measured by its ability to inhibit IL-36 beta induced IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.7930-0.8070 μg/mL, corresponding to a specific activity is 1239.1574-1261.034 U/mg, in the presence of 15 ng/mL of Recombinant Mouse IL-36 beta/IL-1F8.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Sci Rep
2026 May 9;16(1):21231. PMID: 42103804 -
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
NP_062324.2 (V3-D156)
-
Molecular Construction
-
N-term
-
IL-36RN (V3-D156)
Accession # NP_062324.2 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL36RN; IL-1ra Homolog 1; Prev. IL1F5; IL-36Ra; IL1HY1; IL-1F5 (IL-1HY1, FIL1-Delta, IL-1RP3, IL-1L1, IL-1-Delta); IL1RP3; IL1F5 (Canonical Product IL-1F5a); FIL1D; Family Of Interleukin 1-Delta; IL1L1; Interleukin-1 Family Member 5; Interleukin-1 Recepto
-
AA Sequence
VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
