1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-5
  5. IL-5 Protein, Rat

IL-5 Protein, Rat

Cat. No.: HY-P7102
COA Handling Instructions

IL-5 Protein, Rat, a T-cell derived cytokine, stimulates B cell growth and increases immunoglobulin secretion.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $115 In-stock
50 μg $325 In-stock
100 μg $550 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-5 Protein, Rat, a T-cell derived cytokine, stimulates B cell growth and increases immunoglobulin secretion.

Background

Interleukin-5 (IL-5) is a T-cell derived cytokine which stimulates eosinophil production and activation in human, mice and sheep. IL-5 is active as a growth factor for mouse but not human B cells. The role of IL-5 on ruminant B cells has not been clearly defined. By hybridisation with human IL-5 cDNA, the ovine IL-5 gene is isolated from a liver genomic library. The IL-5 cDNA is obtained by reverse-transcriptase PCR using primers designed from the 5' and 3' coding sequence derived from the ovine IL-5 gene. The sequences of the cDNA shows that there is 79% and 73% nucleotide homology with the human and mouse sequences. The ovine IL-5 cDNA encodes a protein of 132 amino acids and the level of amino acid homology with human and mouse IL-5 is 64% and 56%, respectively. Two cysteine residues are conserved in ovine, human and mouse IL-5. There are two potential N-linked glycoyslation sites in ovine IL-5[1].

Biological Activity

The ED50 is <0.4 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >2.5 × 106 units/mg.

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q9R2C9 (M20-V132)

Gene ID
Molecular Construction
N-term
IL-5 (M20-V132)
Accession # Q9R2C9
C-term
Synonyms
rRtIL-5; EDF; BCDFII; TRF
AA Sequence

MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV

Molecular Weight

Approximately 26.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris, pH 8.5.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-5 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-5 Protein, Rat
Cat. No.:
HY-P7102
Quantity:
MCE Japan Authorized Agent: