1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-5
  5. IL-5 Protein, Canine (sf9, His)

IL-5 protein is expressed by T lymphocytes and NK cells and plays a crucial role in eosinophil survival, differentiation, and chemotaxis. It also promotes immunoglobulin production, growth and differentiation in B cells. IL-5 Protein, Canine (sf9, His) is the recombinant canine-derived IL-5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-5 protein is expressed by T lymphocytes and NK cells and plays a crucial role in eosinophil survival, differentiation, and chemotaxis. It also promotes immunoglobulin production, growth and differentiation in B cells. IL-5 Protein, Canine (sf9, His) is the recombinant canine-derived IL-5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

IL-5 Protein is a homodimeric cytokine mainly expressed by T-lymphocytes and NK cells, playing a crucial role in the survival, differentiation, and chemotaxis of eosinophils. It also acts on B-cells, promoting immunoglobulin production, growth, and differentiation. Mechanistically, IL-5 Protein exerts its effects by binding to a receptor composed of IL5RA and CSF2RB subunits, activating kinases such as LYN, SYK, and JAK2. This activation leads to signal propagation through the RAS-MAPK and JAK-STAT5 pathways. IL-5 Protein exists as a disulfide-linked homodimer and interacts with IL5RA and CSF2RB subunits.

Species

Canine

Source

Sf9 insect cells

Tag

N-His

Accession

Q95J76 (V22-S134)

Gene ID
Molecular Construction
N-term
His
IL-5 (V22-S134)
Accession # Q95J76
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-5; IL-5; EDF; Eo-CSF; TRF
AA Sequence

VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES

Predicted Molecular Mass
14.5 kDa
Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-5 Protein, Canine (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-5 Protein, Canine (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-5 Protein, Canine (sf9, His)
Cat. No.:
HY-P73218
Quantity:
MCE Japan Authorized Agent: