IL-5 Protein, Canine (sf9, His)
IL-5 protein is expressed by T lymphocytes and NK cells and plays a crucial role in eosinophil survival, differentiation, and chemotaxis. It also promotes immunoglobulin production, growth and differentiation in B cells. IL-5 Protein, Canine (sf9, His) is the recombinant canine-derived IL-5 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Canine
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-5 protein is expressed by T lymphocytes and NK cells and plays a crucial role in eosinophil survival, differentiation, and chemotaxis. It also promotes immunoglobulin production, growth and differentiation in B cells. IL-5 Protein, Canine (sf9, His) is the recombinant canine-derived IL-5 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
IL-5 Protein is a homodimeric cytokine mainly expressed by T-lymphocytes and NK cells, playing a crucial role in the survival, differentiation, and chemotaxis of eosinophils. It also acts on B-cells, promoting immunoglobulin production, growth, and differentiation. Mechanistically, IL-5 Protein exerts its effects by binding to a receptor composed of IL5RA and CSF2RB subunits, activating kinases such as LYN, SYK, and JAK2. This activation leads to signal propagation through the RAS-MAPK and JAK-STAT5 pathways. IL-5 Protein exists as a disulfide-linked homodimer and interacts with IL5RA and CSF2RB subunits.
Technical Parameters
-
Species Canine
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q95J76 (V22-S134)
-
Molecular Construction
-
N-term
-
His
-
IL-5 (V22-S134)
Accession # Q95J76 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL5; T-Cell Replacing Factor; Interleukin 5; EDF; Eosinophil Differentiation Factor; Colony-Stimulating Factor, Eosinophil; Interleukin-5; B-Cell Differentiation Factor I; IL-5; Interleukin 5 (Colony-Stimulating Factor, Eosinophil); TRF; B Cell Differenti
-
AA Sequence
VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
