IL-5 Protein, Canine (sf9, His)

IL-5 protein is expressed by T lymphocytes and NK cells and plays a crucial role in eosinophil survival, differentiation, and chemotaxis. It also promotes immunoglobulin production, growth and differentiation in B cells. IL-5 Protein, Canine (sf9, His) is the recombinant canine-derived IL-5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-5 protein is expressed by T lymphocytes and NK cells and plays a crucial role in eosinophil survival, differentiation, and chemotaxis. It also promotes immunoglobulin production, growth and differentiation in B cells. IL-5 Protein, Canine (sf9, His) is the recombinant canine-derived IL-5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

IL-5 Protein is a homodimeric cytokine mainly expressed by T-lymphocytes and NK cells, playing a crucial role in the survival, differentiation, and chemotaxis of eosinophils. It also acts on B-cells, promoting immunoglobulin production, growth, and differentiation. Mechanistically, IL-5 Protein exerts its effects by binding to a receptor composed of IL5RA and CSF2RB subunits, activating kinases such as LYN, SYK, and JAK2. This activation leads to signal propagation through the RAS-MAPK and JAK-STAT5 pathways. IL-5 Protein exists as a disulfide-linked homodimer and interacts with IL5RA and CSF2RB subunits.

Technical Parameters

  • Species Canine
  • Source Sf9 insect cells
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • IL-5 (V22-S134)
      Accession # Q95J76
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL5; T-Cell Replacing Factor; Interleukin 5; EDF; Eosinophil Differentiation Factor; Colony-Stimulating Factor, Eosinophil; Interleukin-5; B-Cell Differentiation Factor I; IL-5; Interleukin 5 (Colony-Stimulating Factor, Eosinophil); TRF; B Cell Differenti

  • AA Sequence

    VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES

  • Predicted Molecular Mass

    14.5 kDa

  • Molecular Weight

    Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00