1. Recombinant Proteins
  2. IL-5 Protein, Mouse (CHO)

IL-5 Protein, Mouse (CHO)

Cat. No.: HY-P7081A
Handling Instructions

IL-5 Protein, Mouse (CHO) is a CHO cell derived hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg $600 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-5; EDF; BCDFII; TRF
Species

Mouse

Source

CHO

Accession

P04401 (M21-G133)

Gene ID

16191

Molecular Weight

25-40 kDa

AA Sequence

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Biological Activity
The ED50 is <0.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >2 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-5 (IL-5), which is produced primarily by type 2 T helper lymphocytes (Th2), is an eosinophil differentiation and activation factor. Antagonism of IL-5 activity is being explored as a potential treatment of a number of disease conditions associated with eosinophils in animal models[1]. Interleukin-5 (IL-5) which was previously named T cell replacing factor, B cell growth and differentiation factor, colony forming unit growth stimulating factor and eosinophil differentiation factor is produced predominantly by T cells. Mouse IL-5 is active as a growth factor on mouse but not human B cells. Mouse IL-5 stimulates the production and secretion of IgM and IgA by B cells in synergism with bacterial endotoxins. IL-5 has also been found to promote the generation of cytotoxic cells from human and mouse thymocytes. IL-5 is a potent growth promoter of early haemopoeitic progenitor cells. It stimulates the production of eosinophits from mouse, human and sheep in vitro and controls the production of eosinophils in vivo. Mouse IL-5 possesses eosinophil potentiating activity[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-5 Protein, Mouse (CHO)
Cat. No.:
HY-P7081A
Quantity:
MCE Japan Authorized Agent: