1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-5
  5. IL-5 Protein, Mouse (CHO)

IL-5 Protein, Mouse (CHO)

Cat. No.: HY-P7081A
Handling Instructions

IL-5 Protein, Mouse (CHO) is a CHO cell derived hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg $600 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-5 Protein, Mouse (CHO) is a CHO cell derived hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

Background

Interleukin-5 (IL-5), which is produced primarily by type 2 T helper lymphocytes (Th2), is an eosinophil differentiation and activation factor. Antagonism of IL-5 activity is being explored as a potential treatment of a number of disease conditions associated with eosinophils in animal models[1]. Interleukin-5 (IL-5) which was previously named T cell replacing factor, B cell growth and differentiation factor, colony forming unit growth stimulating factor and eosinophil differentiation factor is produced predominantly by T cells. Mouse IL-5 is active as a growth factor on mouse but not human B cells. Mouse IL-5 stimulates the production and secretion of IgM and IgA by B cells in synergism with bacterial endotoxins. IL-5 has also been found to promote the generation of cytotoxic cells from human and mouse thymocytes. IL-5 is a potent growth promoter of early haemopoeitic progenitor cells. It stimulates the production of eosinophits from mouse, human and sheep in vitro and controls the production of eosinophils in vivo. Mouse IL-5 possesses eosinophil potentiating activity[2].

Biological Activity
The ED50 is <0.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >2 × 106 units/mg.
Species

Mouse

Source

CHO

Accession

P04401 (M21-G133)

Gene ID
Synonyms
rMuIL-5; EDF; BCDFII; TRF
AA Sequence

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Weight

25-40 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-5 Protein, Mouse (CHO) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-5 Protein, Mouse (CHO)
Cat. No.:
HY-P7081A
Quantity:
MCE Japan Authorized Agent: