1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-9
  5. Animal-Free IL-9 Protein, Mouse (His)

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.Animal-Free IL-9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-9 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
2 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.Animal-Free IL-9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-9 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Background

IL-9, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes and also by mast cells or NKT cells, assumes crucial roles in the immune response against parasites. Beyond its anti-parasitic function, IL-9 influences intestinal epithelial permeability and adaptive immunity. It plays a pivotal role in inducing the differentiation of specific T-cell subsets, such as IL-17-producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Mechanistically, IL-9 exerts its diverse biological effects through a receptor comprised of the IL9R subunit and the signal transducing subunit IL2RG. Stimulation of this receptor leads to rapid activation of JAK1 and JAK3 kinase activities, initiating STAT1, STAT3, and STAT5-mediated transcriptional programs. The induction of differentiation genes appears to be mediated by STAT1 alone, while the protection of cells from apoptosis depends on the concerted actions of STAT3 and STAT5. IL-9 interacts directly with IL9R and IL2RG, orchestrating a sophisticated network of interactions to modulate immune responses and cellular processes.

Biologische Aktivität

Measure by its ability to induce proliferation in MO7e cells.The ED50 for this effect is<0.2 ng/mL.The specific activity of recombinant mouse IL9 is >5 x106 IU/mg.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P15247 (Q19-P144)

Gene ID
Molecular Construction
N-term
6*His
IL-9 (Q19-P144)
Accession # P15247
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuIL-9; Cytokine P40; T-cell Growth Factor P40
AA Sequence

QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Predicted Molecular Mass
15 kDa
Molekulargewicht

Approximately 11-15 kDa, based on SDS-PAGE under reducing conditions.

Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

Animal-Free IL-9 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Animal-Free IL-9 Protein, Mouse (His)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Animal-Free IL-9 Protein, Mouse (His)
Art. -Nr.:
HY-P700218AF
Menge:
MCE Japan Authorized Agent: