Animal-Free IL-9 Protein, Mouse (His)
Based on 1 Customer Validation
IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.Animal-Free IL-9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-9 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.Animal-Free IL-9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-9 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Background
IL-9, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes and also by mast cells or NKT cells, assumes crucial roles in the immune response against parasites. Beyond its anti-parasitic function, IL-9 influences intestinal epithelial permeability and adaptive immunity. It plays a pivotal role in inducing the differentiation of specific T-cell subsets, such as IL-17-producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Mechanistically, IL-9 exerts its diverse biological effects through a receptor comprised of the IL9R subunit and the signal transducing subunit IL2RG. Stimulation of this receptor leads to rapid activation of JAK1 and JAK3 kinase activities, initiating STAT1, STAT3, and STAT5-mediated transcriptional programs. The induction of differentiation genes appears to be mediated by STAT1 alone, while the protection of cells from apoptosis depends on the concerted actions of STAT3 and STAT5. IL-9 interacts directly with IL9R and IL2RG, orchestrating a sophisticated network of interactions to modulate immune responses and cellular processes.
Verified Bioactivity
Measure by its ability to induce proliferation in MO7e cells.The ED50 for this effect is<0.2 ng/mL.The specific activity of recombinant mouse IL9 is >5 x106 IU/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P15247 (Q19-P144)
-
Molecular Construction
-
N-term
-
6*His
-
IL-9 (Q19-P144)
Accession # P15247 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL9; Homolog Of Mouse T Cell And Mast Cell Growth Factor 40; Interleukin 9; P40 T-Cell And Mast Cell Growth Factor; IL-9; Interleukin-9; T-Cell Growth Factor P40; P40 Cytokine; HP40; Cytokine P40; P40
-
AA Sequence
QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
-
Predicted Molecular Mass
15 kDa
-
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)