IL-22 Protein, Mouse (CHO)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free. The total length of IL-22 Protein, Mouse (CHO) is 146 a.a., with molecular weight of 20-30 kDa.

IL-22 is a secreted IL-10 family cytokine that plays a critical role in modulating tissue responses during inflammation, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells^[1][2][3][4].
IL-22 is produced by several T cells, ILC3, neutrophils and macrophages, IL-22 has a specific receptor which is composed of IL-22R1 and IL-10R2, presenting on non-immune cells in many organs. Ligation of IL22RA1 with IL22 induces activation of the tyrosine kinases JAK1 and TYK2, which activates STAT3, and p38 MAPK, in turn, promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 promotes phosphorylation of GSK3B at 'Ser-9' and CTTN as well^[5].
IL-22 gets positive regulation from IL-23, IL-1β, IL-7, AhR and Notch, IL-22 gets negative regulation from IL-22BP, TGF-β, IL-27, ICOS, c-Maf and IL-25^[6].

The ED₅₀ as determined by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells) is less than 0.5 ng/mL.

Mouse

CHO

Tag Free

Q9JJY9 (L34-V179)

50929  [NCBI]

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

20-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<0.2 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.