Copy Link Print Information

IL-22 Protein, Mouse (CHO)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-22 Protein, Mouse (CHO)
  • IL-22 Protein, Mouse (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

Background

IL-22 is a secreted IL-10 family cytokine that plays a critical role in modulating tissue responses during inflammation, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells[1][2][3][4].
IL-22 is produced by several T cells, ILC3, neutrophils and macrophages, IL-22 has a specific receptor which is composed of IL-22R1 and IL-10R2, presenting on non-immune cells in many organs. Ligation of IL22RA1 with IL22 induces activation of the tyrosine kinases JAK1 and TYK2, which activates STAT3, and p38 MAPK, in turn, promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 promotes phosphorylation of GSK3B at 'Ser-9' and CTTN as well[5].
IL-22 gets positive regulation from IL-23, IL-1β, IL-7, AhR and Notch, IL-22 gets negative regulation from IL-22BP, TGF-β, IL-27, ICOS, c-Maf and IL-25[6].

Verified Bioactivity

The ED50 as determined by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells) is less than 0.5 ng/mL.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession

    Q9JJY9 (L34-V179)

  • Gene ID
    50929  [NCBI]
  • Molecular Construction
    • N-term
    • IL-22 (L34-V179)
      Accession # Q9JJY9
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL22; TIFa; Interleukin 22; IL-10-Related T-Cell-Derived Inducible Factor; IL-TIF; Cytokine Zcyto18; ILTIF; Interleukin-22; IL-22; MGC79382; TIFIL-23; MGC79384; Zcyto18; IL-10-Related T-Cell-Derived-Inducible Factor; IL-D110; Interferon 2B1; IL-21; ZCYTO1

  • AA Sequence

    LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

  • Molecular Weight

    Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • IL-22 Protein, Mouse (CHO) Product Image
    1/16
  • Experimental Validation Results for IL-22 Protein, Mouse (CHO)
  • IL-22 Protein, Mouse (CHO) Product Image