Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, serves a pivotal role in migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, instigating contact-dependent bidirectional signaling. Crucial in angiogenesis and tumor neovascularization, EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration depend on the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2. Notably, EFNA1 exerts anti-oncogenic effects by activating and down-regulating EPHA2 through induced tyrosine phosphorylation, leading to internalization and degradation. In gliomas, it acts as a negative regulator, down-regulating EPHA2 and FAK and thus playing a role in suppressing tumorigenesis. EFNA1 can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as both a monomer and homodimer, it forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases including EPHA1, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7.
Verified Bioactivity
Measured by its ability to compete with mouse EFNA1 for binding to immobilized mouse EphA2 in a functional ELISA assay.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P52793 (D19-S182)
-
Molecular Construction
-
N-term
-
EFNA1 (D19-S182)
Accession # P52793 -
His
-
C-term
-
-
Protein Length
Full Length of Ephrin-A1 Chain
-
Synonyms
EFNA1; GMAN; Prev. TNFAIP4; Tumor Necrosis Factor Alpha-Induced Protein 4; Prev. EPLG1; TNF Alpha-Induced Protein 4; EPH-Related Receptor Tyrosine Kinase Ligand 1; LERK-1; Ephrin-A1; Tumor Necrosis Factor, Alpha-Induced Protein 4; LERK1; Epididymis Secretory Sperm Binding Protein; Immediate Early Response Protein B61; Ligand Of Eph-Related Kinase 1; ECKLG; B61; Ephrin A1; Gastric Cancer Metastasis Associated Long Noncoding RNA
-
AA Sequence
DRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)