Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, serves a pivotal role in migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, instigating contact-dependent bidirectional signaling. Crucial in angiogenesis and tumor neovascularization, EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration depend on the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2. Notably, EFNA1 exerts anti-oncogenic effects by activating and down-regulating EPHA2 through induced tyrosine phosphorylation, leading to internalization and degradation. In gliomas, it acts as a negative regulator, down-regulating EPHA2 and FAK and thus playing a role in suppressing tumorigenesis. EFNA1 can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as both a monomer and homodimer, it forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases including EPHA1, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7.

Verified Bioactivity

Measured by its ability to compete with mouse EFNA1 for binding to immobilized mouse EphA2 in a functional ELISA assay.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EFNA1 (D19-S182)
      Accession # P52793
    • His
    • C-term
  • Protein Length

    Full Length of Ephrin-A1 Chain

  • Synonyms

    EFNA1; GMAN; Prev. TNFAIP4; Tumor Necrosis Factor Alpha-Induced Protein 4; Prev. EPLG1; TNF Alpha-Induced Protein 4; EPH-Related Receptor Tyrosine Kinase Ligand 1; LERK-1; Ephrin-A1; Tumor Necrosis Factor, Alpha-Induced Protein 4; LERK1; Epididymis Secretory Sperm Binding Protein; Immediate Early Response Protein B61; Ligand Of Eph-Related Kinase 1; ECKLG; B61; Ephrin A1; Gastric Cancer Metastasis Associated Long Noncoding RNA

  • AA Sequence

    DRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00