1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A1
  6. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)

Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P73024
Handling Instructions

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is 164 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is 164 a.a., with molecular weight of ~27 kDa.

Background

The Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, serves a pivotal role in migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, instigating contact-dependent bidirectional signaling. Crucial in angiogenesis and tumor neovascularization, EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration depend on the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2. Notably, EFNA1 exerts anti-oncogenic effects by activating and down-regulating EPHA2 through induced tyrosine phosphorylation, leading to internalization and degradation. In gliomas, it acts as a negative regulator, down-regulating EPHA2 and FAK and thus playing a role in suppressing tumorigenesis. EFNA1 can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as both a monomer and homodimer, it forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases including EPHA1, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P52793 (D19-S182)

Gene ID

13636  [NCBI]

Molecular Construction
N-term
EFNA1 (D19-S182)
Accession # P52793
His
C-term
Synonyms
Ephrin-A1; LERK-1; TNF alpha-induced protein 4; EFNA1; EPLG1; TNFAIP4
AA Sequence

MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS

Molecular Weight

Approximately 27 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73024
Quantity:
MCE Japan Authorized Agent: