1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Tissue Inhibitor of Metalloproteinase (TIMPs)
  5. TIMP-2
  6. TIMP-2 Protein, Human (HEK293, His)

TIMP-2 Protein, Human (HEK293, His)

Cat. No.: HY-P71117
SDS COA Handling Instructions

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIMP-2 Protein, Human (HEK293, His) is 194 a.a., with molecular weight of 23-26 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

TIMP-2 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIMP-2 Protein, Human (HEK293, His) is 194 a.a., with molecular weight of 23-26 kDa.

Background

TIMP-2, a tissue inhibitor of metalloproteinases, forms stable complexes with various metalloproteinases, particularly collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. This regulatory action encompasses a spectrum of metalloproteinases, including MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16, and MMP-19. Notably, TIMP-2's intricate interactions extend to MMP2, where binding occurs via the C-terminal region, specifically interacting with the C-terminal PEX domain of MMP2, resulting in the inhibition of MMP2 activity. This dynamic interplay underscores TIMP-2's role as a versatile modulator in regulating the activity of metalloproteinases critical for extracellular matrix remodeling and tissue homeostasis.

Biological Activity

Measured by its ability to inhibit human MMP-2(HY-P73296)cleavage of a fluorogenic peptide 5µM substrate Mca-PLGL-Dpa-AR-NH2 (HY-131498) incubate at room temperature in kinetic mode for 5 minutes.The IC50 is1.796 nM.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P16035 (C27-P220)

Gene ID
Molecular Construction
N-term
TIMP-2 (C27-P220)
Accession # P16035
6*His
C-term
Synonyms
Metalloproteinase Inhibitor 2; CSC-21K; Tissue Inhibitor of Metalloproteinases 2; TIMP-2; TIMP2
AA Sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Weight

23-26 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TIMP-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIMP-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71117
Quantity:
MCE Japan Authorized Agent: