Copy Link Print Information

TIMP-2 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TIMP-2 Protein, Human (HEK293, His)
  • TIMP-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TIMP-2, a tissue inhibitor of metalloproteinases, forms stable complexes with various metalloproteinases, particularly collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. This regulatory action encompasses a spectrum of metalloproteinases, including MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16, and MMP-19. Notably, TIMP-2's intricate interactions extend to MMP2, where binding occurs via the C-terminal region, specifically interacting with the C-terminal PEX domain of MMP2, resulting in the inhibition of MMP2 activity. This dynamic interplay underscores TIMP-2's role as a versatile modulator in regulating the activity of metalloproteinases critical for extracellular matrix remodeling and tissue homeostasis.

Verified Bioactivity

Measured by its ability to inhibit human MMP-2(HY-P73296) cleavage of a fluorogenic peptide 5µM substrate Mca-PLGL-Dpa-AR-NH2 (HY-131498) incubate at room temperature in kinetic mode for 5 minutes.The IC50 is1.796 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P16035 (C27-P220)

  • Gene ID
    7077  [NCBI]
  • Molecular Construction
    • N-term
    • TIMP-2 (C27-P220)
      Accession # P16035
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TIMP2; Tissue Inhibitor Of Metalloproteinase 2; TIMP Metallopeptidase Inhibitor 2; Testicular Secretory Protein Li 57; CSC-21K; TIMP-2; Tissue Inhibitor Of Metalloproteinases 2; DDC8; Metalloproteinase Inhibitor 2

  • AA Sequence

    CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

  • Predicted Molecular Mass

    22.8 kDa

  • Molecular Weight

    Approximately 23-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • TIMP-2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TIMP-2 Protein, Human (HEK293, His)
  • TIMP-2 Protein, Human (HEK293, His) Product Image