TIMP-2 Protein, Human (HEK293)
Based on 1 Customer Validation
TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with tag free.
Background
TIMP-2, a tissue inhibitor of metalloproteinases, forms stable complexes with various metalloproteinases, particularly collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. This regulatory action encompasses a spectrum of metalloproteinases, including MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16, and MMP-19. Notably, TIMP-2's intricate interactions extend to MMP2, where binding occurs via the C-terminal region, specifically interacting with the C-terminal PEX domain of MMP2, resulting in the inhibition of MMP2 activity. This dynamic interplay underscores TIMP-2's role as a versatile modulator in regulating the activity of metalloproteinases critical for extracellular matrix remodeling and tissue homeostasis.
Verified Bioactivity
Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate MCA-PLGL-DPA-AR-NH2 and the IC50 value is < 4 nM.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P16035 (C27-P220)
-
Molecular Construction
-
N-term
-
TIMP-2 (C27-P220)
Accession # P16035 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TIMP2; Tissue Inhibitor Of Metalloproteinase 2; TIMP Metallopeptidase Inhibitor 2; Testicular Secretory Protein Li 57; CSC-21K; TIMP-2; Tissue Inhibitor Of Metalloproteinases 2; DDC8; Metalloproteinase Inhibitor 2
-
AA Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
-
Predicted Molecular Mass
22 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)