PD-L1 Protein, Canine (HEK293, Fc)

PD-L1 Protein, Canine (HEK293, Fc) is a trans-membrane protein that is considered to be a co-inhibitory factor of the immune response. The amino acid sequence of PD-L1 is encoded by 7 exons, which form a protein of ~40 kDa. PD-L1 is a type I transmembrane protein, is part of the immunoglobulin (Ig) superfamily and is composed of IgV-like and IgC-like extracellular domains, a hydrophobic transmembrane domain and a short cytoplasmic tail composed of 30 amino acids. PD-L1 can combine with PD-1 to reduce the proliferation of PD-1 positive cells, inhibit their cytokine secretion and induce apoptosis. PD-L1 also plays an important role in various malignancies where it can attenuate the host immune response to tumor cells^[1][2]. PD-L1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-L1 protein, expressed by HEK293 , with C-hFc labeled tag.

PD-L1 is the third member of the B7 family that does not bind CD28, cytotoxic T-lymphocyte A4 or inducible co-stimulator, and has 10-25% homology with B7.1 and B7.2 proteins. PD-L1 is encoded by the PDCDL1 gene, which was discovered at p24.1 on human chromosome 9^[1].
The most important role of PD-L1 is binding with programmed death-1 (PD-1; CD279), a type I transmembrane receptor that is 288 amino acids long and was first found on T cells. The engagement of PD-L1 and PD-1 on cancer cells activates Src homology region 2 domain-containing phosphatases, which inhibit the T cell receptor (TCR) pathway. Inhibition of the TCR pathway leads to inhibition of T cell activities, including proliferation, survival and cytokine production, such as that of IL-2, tumour necrosis factor α (TNF-α) and interferon γ (IFN-γ), as well as the inhibition of B7-1 and T cell tolerance^[1].

Measured by its binding ability in a functional ELISA. When Recombinant Canine PD-1 is present at 0.5 μg/mL, can bind Recombinant Canine PD-L1. The ED₅₀ for this effect is ≤5.0 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Canine PD-1 is present at 0.5 μg/mL, can bind Recombinant Canine PD-L1. The ED₅₀ for this effect is 4.116 μg/mL.

Canine

HEK293

C-hFc

NP_001278901 (F19-R236)

484186  [NCBI]

Partial

FTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASER

Approximately 70-80&140-160 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.