Copy Link Print Information

PD-L1 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PD-L1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for PD-L1 Protein, Rat (HEK293, His)
  • PD-L1 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Programmed death-ligand 1 (PD-L1) plays a critical role in the positive regulation of T cell proliferation and cell migration. Situated on the cell surface, PD-L1 serves as a biomarker for conditions such as periodontitis and pre-eclampsia. Its orthologous counterpart in humans is CD274 (CD274 molecule). With biased expression observed in the thymus (RPKM 102.9), spleen (RPKM 58.3), and various other tissues, PD-L1 is central to immune regulation and holds significance in the context of diverse physiological and pathological conditions.

Verified Bioactivity

1. Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is 0.1872 μg/ml in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×10^3 units/mg.
2. Measured by its binding ability in a functional ELISA. When Recombinant Rat PD-1 is present at 1 μg/mL, can bind Recombinant Rat PD-L1. The ED50 for this effect is 0.526 μg/mL.
3.Measured by its binding ability in a functional ELISA. Immobilized Rat PD-1 at 2 μg/mL (100 μl/well) can bind Biotinylated Rat PD-L1. The ED50 for this effect is 80-110 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.1872 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×103 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-10*His
  • Accession

    NP_001178883.1 (A18-T238)

  • Gene ID
    499342  [NCBI]
  • Molecular Construction
    • N-term
    • PD-L1 (A18-T238)
      Accession # NP_001178883.1
    • 10*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD274; B7 Homolog 1; Prev. PDCD1LG1; B7-H; PD-L1; PDCD1 Ligand 1; B7H1; PDCD1L1; PDL1; HPD-L1; Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; CD274 Antigen; ADMIO5; CD274 Molecule; B7-H1

  • AA Sequence

    AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT

  • Molecular Weight

    Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.1872 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×103 units/mg.

  • PD-L1 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PD-L1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for PD-L1 Protein, Rat (HEK293, His)
  • PD-L1 Protein, Rat (HEK293, His) Product Image