Copy Link Print Information

PD-L1 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PD-L1 Protein, Cynomolgus (HEK293, His)
  • PD-L1 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD274 molecule is also known as programmed death ligand 1 (PD-L1), and PD-L1 binds to the inhibitory checkpoint molecule PD-1 and interacts with phosphatase (SHP-1 or SHP-2) through the immune receptor tyrosinyl switch Motif (ITSM) to transmit inhibitory signals. The binding of PD-L1 to its receptor PD-1 on T cells transmits signals that inhibit TCR-mediated IL-2 production and T cell proliferation. By inhibiting ZAP70 phosphorylation and its association with CD3ζ. PD-1 signaling attenuates PKC-θ-activated ring phosphorylation (caused by TCR signaling), which is required for the activation of the transcription factors NF-κB and AP-1 and the production of IL-2. PD-L1 binding to PD-1 is also induced by the upregulation of the E3 ubiquitin ligase CPL-B. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence[1][2][3][4].

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus PD-L1 at 1 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus PD-1 (HY-P70676). The ED50 for this effect is 0.121 μg/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized Anti-Human PDL1 Antibody (ATE_bio, Research Grade) at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus PD-L1 (C-6His).The ED50 of Recombinant Cynomolgus PD-L1 (C-6His) is 40-70 ng/mL.
3.Loaded Anti-Human PDL1 Antibody on Pro-A Biosensor, can bind Recombinant Cynomolgus PD-L1 with an affinity constant of 5-20 uM as determined in BLI assay.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus PD-L1 at 1 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus PD-1 (HY-P70676). The ED50 for this effect is 0.121 μg/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession

    G7PSE7 (F19-T239)

  • Gene ID
    102145573  [NCBI]
  • Molecular Construction
    • N-term
    • PD-L1 (F19-T239)
      Accession # G7PSE7
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD274; B7 Homolog 1; Prev. PDCD1LG1; B7-H; PD-L1; PDCD1 Ligand 1; B7H1; PDCD1L1; PDL1; HPD-L1; Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; CD274 Antigen; ADMIO5; CD274 Molecule; B7-H1

  • AA Sequence

    FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

  • Predicted Molecular Mass

    27.1 kDa

  • Molecular Weight

    Approximately 32-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus PD-L1 at 1 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus PD-1 (HY-P70676). The ED50 for this effect is 0.121 μg/mL.

  • PD-L1 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PD-L1 Protein, Cynomolgus (HEK293, His)
  • PD-L1 Protein, Cynomolgus (HEK293, His) Product Image