PD-L1 Protein, Cynomolgus (HEK293, His)

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag.

CD274 molecule is also known as programmed death ligand 1 (PD-L1), and PD-L1 binds to the inhibitory checkpoint molecule PD-1 and interacts with phosphatase (SHP-1 or SHP-2) through the immune receptor tyrosinyl switch Motif (ITSM) to transmit inhibitory signals. The binding of PD-L1 to its receptor PD-1 on T cells transmits signals that inhibit TCR-mediated IL-2 production and T cell proliferation. By inhibiting ZAP70 phosphorylation and its association with CD3ζ. PD-1 signaling attenuates PKC-θ-activated ring phosphorylation (caused by TCR signaling), which is required for the activation of the transcription factors NF-κB and AP-1 and the production of IL-2. PD-L1 binding to PD-1 is also induced by the upregulation of the E3 ubiquitin ligase CPL-B. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence^[1][2][3][4].

1.Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus PD-L1 at 1 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus PD-1 (HY-P70676). The ED₅₀ for this effect is 0.121 μg/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized Anti-Human PDL1 Antibody (ATE_bio, Research Grade) at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus PD-L1 (C-6His).The ED₅₀ of Recombinant Cynomolgus PD-L1 (C-6His) is 40-70 ng/mL.
3.Loaded Anti-Human PDL1 Antibody on Pro-A Biosensor, can bind Recombinant Cynomolgus PD-L1 with an affinity constant of 15-20 uM as determined in BLI assay.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus PD-L1 at 1 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus PD-1 (HY-P70676). The ED₅₀ for this effect is 0.121 μg/mL.

Cynomolgus

HEK293

C-6*His

G7PSE7 (F19-T239)

102145573  [NCBI]

Partial

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

32-40 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.