Copy Link Print Information

PD-L1 Protein, Human (HEK293)

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Human (HEK293) is the recombinant human-derived PD-L1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • PD-L1 Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Human (HEK293) is the recombinant human-derived PD-L1 protein, expressed by HEK293 , with tag free.

Background

PD-L1 Protein assumes a critical role in both the induction and maintenance of immune tolerance to self, acting as a ligand for the inhibitory receptor PDCD1/PD-1 and thereby modulating the activation threshold of T-cells, ultimately limiting their effector response. Additionally, PD-L1 may function as a costimulatory molecule for T-cell subsets that predominantly produce interleukin-10 (IL10) through an as yet unidentified activating receptor. Beyond its role as an immune checkpoint, PD-L1 also acts as a transcription coactivator, translocating into the nucleus in response to hypoxia and interacting with phosphorylated STAT3 to promote the transcription of GSDMC, leading to pyroptosis. Exploited by tumors to attenuate anti-tumor immunity and escape immune system destruction, the PDCD1-mediated inhibitory pathway facilitated by PD-L1 interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. Blocking the PDCD1-mediated pathway has shown promise in reversing exhausted T-cell phenotypes and normalizing anti-tumor responses, providing a rationale for cancer immunotherapy.

Verified Bioactivity

1.Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.2111 μg/ml in the presence of 10 μg/mL anti-CD3.
2.Measured by its binding ability in a functional ELISA. Immobilized Human PD-L1 at 1 μg/mL (100 μL/well) can bind Human PD-1. The ED50 for this effect is ≤0.8996 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    Q9NZQ7-1/NP_054862.1 (F19-R238)

  • Gene ID
    29126  [NCBI]
  • Molecular Construction
    • N-term
    • PD-L1 (F19-R238)
      Accession # Q9NZQ7-1/NP_054862.1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD274; B7 Homolog 1; Prev. PDCD1LG1; B7-H; PD-L1; PDCD1 Ligand 1; B7H1; PDCD1L1; PDL1; HPD-L1; Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; CD274 Antigen; ADMIO5; CD274 Molecule; B7-H1

  • AA Sequence

    FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

  • Predicted Molecular Mass

    25.2 kDa

  • Molecular Weight

    Approximately 31-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
2. Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL‑2 mouse cytotoxic T cells. The ED50 for this effect is 0.2191 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 4.56×103 units/mg.

  • 1/16

    PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Biosens Bioelectron. 2025 May 1:275:117236. [Abstract]

    Customer Validation
     SWV curves obtained on bare SPCE, Fe3O4-SA/SPCE, and PD-L1-apt-AuNPs/Fe3O4-SA/SPCE toward 10 ng/mL PD-L1 (PD-L1 Protein, Human (HEK293), HY-P73361) (30 min).

  • 1/16

    PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: J Med Chem. 2023 Dec 28;66(24):16807-16827. [Abstract]

    Customer Validation
     T-cell recovery activity assay in Jurkat cells. Stim. group, Jurkat cells activated by the CD3/CD28 T-cell activator; PD-L1 (PD-L1 Protein, Human (HEK293), HY-P73361) (24 h) group, adding PD-L1 to Jurkat cells followed by the T-cell activator.

  • 1/16

    PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Eur J Med Chem. 2023 Aug 5:256:115468. [Abstract]

    Customer Validation
     Effect of compound D3 on T cells recovery activity in Jurkat cells. T cell recovery activity was determined by IFN-γ release level detected by ELISA kit. The results showed that, compared with the control group, the anti-CD3/CD28 greatly increased the expression of IFN-γ, which was markedly reduced by addition of human PD-L1 protein (PD-L1 Protein, Human (HEK293), HY-P7336) (24 h).

  • 1/16

    PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: OncoImmunology. 2023 Oct 5;12(1):2265703. [Abstract]

    Customer Validation
     PDL1 (PD-L1 Protein, Human (HEK293) (24 h)).
    Coculture of EGFRz-CAR T cells or Ez.CISR T cells with target cells (c, Daudi-E and Daudi-E.P cells; d, Daudi-E cells and Daudi-E.155 cells) at E:T ratios of 1:1, 5:1, and 10:1. After 24 hours, culture supernatants were collected, and levels of IL-2 were measured by enzyme-linked immunosorbent assays (means ± SDs, n = 3).

  • PD-L1 Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • Experimental Validation Results for PD-L1 Protein, Human (HEK293)
  • PD-L1 Protein, Human (HEK293) Product Image

  • PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Biosens Bioelectron. 2025 May 1:275:117236. [Abstract]

    SWV curves obtained on bare SPCE, Fe3O4-SA/SPCE, and PD-L1-apt-AuNPs/Fe3O4-SA/SPCE toward 10 ng/mL PD-L1 (PD-L1 Protein, Human (HEK293), HY-P73361) (30 min).

  • PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: J Med Chem. 2023 Dec 28;66(24):16807-16827. [Abstract]

    T-cell recovery activity assay in Jurkat cells. Stim. group, Jurkat cells activated by the CD3/CD28 T-cell activator; PD-L1 (PD-L1 Protein, Human (HEK293), HY-P73361) (24 h) group, adding PD-L1 to Jurkat cells followed by the T-cell activator.

  • PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Eur J Med Chem. 2023 Aug 5:256:115468. [Abstract]

    Effect of compound D3 on T cells recovery activity in Jurkat cells. T cell recovery activity was determined by IFN-γ release level detected by ELISA kit. The results showed that, compared with the control group, the anti-CD3/CD28 greatly increased the expression of IFN-γ, which was markedly reduced by addition of human PD-L1 protein (PD-L1 Protein, Human (HEK293), HY-P7336) (24 h).

  • PD-L1 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: OncoImmunology. 2023 Oct 5;12(1):2265703. [Abstract]

    PDL1 (PD-L1 Protein, Human (HEK293) (24 h)).
    Coculture of EGFRz-CAR T cells or Ez.CISR T cells with target cells (c, Daudi-E and Daudi-E.P cells; d, Daudi-E cells and Daudi-E.155 cells) at E:T ratios of 1:1, 5:1, and 10:1. After 24 hours, culture supernatants were collected, and levels of IL-2 were measured by enzyme-linked immunosorbent assays (means ± SDs, n = 3).