1. GPCR/G Protein Stem Cell/Wnt MAPK/ERK Pathway JAK/STAT Signaling Protein Tyrosine Kinase/RTK Metabolic Enzyme/Protease Immunology/Inflammation NF-κB Neuronal Signaling Membrane Transporter/Ion Channel
  2. PACAP Receptor ERK EGFR Reactive Oxygen Species (ROS) Calcium Channel
  3. PACAP (1-38), human, ovine, rat TFA

PACAP (1-38), human, ovine, rat TFA  (Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA)

Cat. No.: HY-P0221A
Instrucciones de manejo Technical Support

PACAP (1-38), human, ovine, rat TFA is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat TFA binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat TFA increases the α-secretase activity. PACAP (1-38), human, ovine, rat TFA elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat TFA demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat TFA can be used for neurotrophic and neuroprotective research.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

Tamaño Stock
50 mg   Obtener un presupuesto  
100 mg   Obtener un presupuesto  
250 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of PACAP (1-38), human, ovine, rat TFA:

Other Forms of PACAP (1-38), human, ovine, rat TFA:

Top Publications Citing Use of Products

    PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49.  [Abstract]

    Latency to eat and food consumption in NSF at 30 min post-PACAP (1-38) (0.4, 2.0, 4.0 ng/site; administrated intrahippocampally in a volume of 0.2 μL) [F (3, 28) = 5.940, P = 0.0029; F (3, 28) = 14.16, P < 0.0001]. The results showed that 30 minutes after the administration of low and medium doses of PACAP (1-38), a shortened feeding latency and increased food intake were observed in the Novelty Suppressed Feeding (NSF) paradigm.

    PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49.  [Abstract]

    Immobility time in FST at 7 d post-PACAP (1-38) [F (3, 28) = 3.415, P = 0.0309] (n = 8). One-way ANOVA, *P < 0.05, **P < 0.01, ***P < 0.001. The immediate and lasting antidepressant activity with the infusion of 0.4 ng/site of hippocampal PACAP (1-38) (administrated intrahippocampally in a volume of 0.2 μL) in mice subjected to chronic mild stress (CMS).

    PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2023 Aug 8;21(1):261.  [Abstract]

    Colocalization of CY5.5-PACAP (4 h), CY3-HA NGs in HA NGs@exosomes from primary neuronal cells by fluorescent microscopy. Scale bar: 50 μm. Immunofluorescence staining showed the co-localization of PACAP (1-38) (200 µg/mL; overnight) and HA nanogels, indicating the successful encapsulation of PACAP (1-38) into HA NGs@exosomes in primary neuronal cells.

    PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705.  [Abstract]

    SCs were treated with various concentrations of PACAP (1-38) (PACAP, 1-100 nM) for 48 h and then FGF17, CTSS and MMP‐12 expression was measured by western blotting. Western blotting showed that PACAP (1-38) (rPACAP) induced expression of FGF17, CTSS and MMP‐12 in SCs.

    PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705.  [Abstract]

    Volcano plot of DEGs in SCs after PACAP (1-38) (100 nM; 48 h) treatment. Analysis of upregulated DEGs induced by PACAP (1-38) showed that fibroblast growth factor 17 (FGF17) expression was significantly upregulated in the treatment group (log2 fold‐change = 2.89, p = 0.0019).

    Ver todos los productos específicos de isoformas PACAP Receptor:

    Ver todos los productos específicos de isoformas ERK:

    Ver todos los productos específicos de isoformas EGFR:

    Ver todos los productos específicos de isoformas Calcium Channel:

    • Actividad biológica

    • Pureza y Documentación

    • Referencias

    • Revisión del cliente

    Descripciòn

    PACAP (1-38), human, ovine, rat TFA is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat TFA binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat TFA increases the α-secretase activity. PACAP (1-38), human, ovine, rat TFA elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat TFA demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat TFA can be used for neurotrophic and neuroprotective research[1][2][3][4][5][6][7].

    IC50 & Target

    IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP1), and 1 nM (PACAP type II receptor VIP2)[1]

    In Vitro

    PACAP (1-38), human, ovine, rat TFA is a fragment of pituitary adenylate cyclase activating polypeptide[1].
    PACAP (1-38), human, ovine, rat TFA shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2].
    In vitro, PACAP (1-38), human, ovine, rat TFA relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].
    PACAP (1-38), human, ovine, rat TFA (100 nM; 2 min; NCI-H838 cells) induces EGFR, HER2 and ERK tyrosine phosphorylation[5].
    PACAP (1-38), human, ovine, rat TFA (100 nM; 30 min; NCI-H838 cells) induces EGFR tyrosine phosphorylation with generates ROS and increases ROS levels by 51%[5].
    PACAP (1-38), human, ovine, rat TFA (10 nM; 48 h) stimulates the growth of NCI-H838 cells[5].
    PACAP (1-38), human, ovine, rat TFA (300 nM; 4 h) stimulates generation of APPsα in neural cells[6].
    PACAP (1-38), human, ovine, rat TFA (0.01-10 nM; HEK 293 cells) stimulates neural cells express endogenous PAC1 receptors by cAMP accumulation and by an increase in cytosolic free calcium and induces elevation of the intracellular Ca2+ concentration in a dose-dependent manner with an EC50 value of 0.81 nM[6].
    PACAP (1-38), human, ovine, rat TFA (0.01 nM; 48 h) elicits potent and efficacious stimulation of NPY secretion from SCG neuronal cultures[7].
    PACAP (1-38), human, ovine, rat TFA (100 nM; 14 d) produces sustained stimulated NPY and catecholamine secretionmpathetic neurons[7].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Cell Viability Assay[1]

    Cell Line: NCI-H838 cells
    Concentration: 10 nM
    Incubation Time: 48 hours
    Result: Increased the number of NCI-H838 cells by 72%.

    Western Blot Analysis[1]

    Cell Line: NCI-H838 cells
    Concentration: 100 nM
    Incubation Time: 2 minutes
    Result: Increased tyrosine phosphorylation of the EGFR, HER2, and ERK by 377, 299 and 216%, respectively.
    In Vivo

    PACAP (1-38), human, ovine, rat TFA alone in sham animals does not result in changes in any of the retinal layers. PACAP (1-38), human, ovine, rat TFA is dissolved in solutio ophthalmica cum benzalkonio leads to significant protection in the retina in bilateral common carotid artery occlusion (BCCAO)-lesioned retinas; retinas treated with PACAP (1-38) eye drops have preserved structure compared to control retinas[4].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Peso molecular

    4534.26 (free base)

    Fòrmula

    C203H331N63O53S.C2HF3O2

    Sequence

    His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

    Sequence Shortening

    HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

    Envío

    Room temperature in continental US; may vary elsewhere.

    Almacenamiento

    Please store the product under the recommended conditions in the Certificate of Analysis.

    Solvente y solubilidad
    In Vitro: 

    H2O

    Peptide Solubility and Storage Guidelines:

    1.  Calculate the length of the peptide.

    2.  Calculate the overall charge of the entire peptide according to the following table:

      Contents Assign value
    Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
    Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
    Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

    3.  Recommended solution:

    Overall charge of peptide Details
    Negative (<0) 1.  Try to dissolve the peptide in water first.
    2.  If water fails, add NH4OH (<50 μL).
    3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
    Positive (>0) 1.  Try to dissolve the peptide in water first.
    2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
    3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
    Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
    2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
    Pureza y Documentación
    Referencias
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    • Calculadora de molaridad

    • Calculadora de dilución

    The molarity calculator equation

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass   Concentration   Volume   Molecular Weight *
    = × ×

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    Nombre del producto

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    PACAP (1-38), human, ovine, rat TFA
    Cat. No.:
    HY-P0221A
    Cantidad:
    MCE Japan Authorized Agent: