Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc)

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand that interacts with Eph receptors and is critical for migration and adhesion. It recruits VAV2, VAV3, and PI3 kinase p85 subunits through EPHA2 phosphorylation, activating RAC1 GTPase for endothelial cell migration. Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.

Ephrin-A1/EFNA1 Protein is a cell surface GPI-bound ligand that interacts with Eph receptors, a family of receptor tyrosine kinases crucial for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling. Ephrin-A1/EFNA1 Protein plays a significant role in angiogenesis and tumor neovascularization by recruiting VAV2, VAV3, and PI3-kinase p85 subunit through phosphorylated EPHA2, leading to RAC1 GTPase activation and vascular endothelial cell migration and assembly. Moreover, it exhibits anti-oncogenic effects in tumor cells by activating and down-regulating EPHA2 through tyrosine phosphorylation, resulting in its internalization and degradation. Furthermore, Ephrin-A1/EFNA1 Protein acts as a negative regulator in glioma tumorigenesis by down-regulating EPHA2 and FAK. It can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Ephrin-A1/EFNA1 Protein exists as a monomer and homodimer, and it forms heterodimers with EPHA2. It binds to several receptor tyrosine kinases including EPHA1, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7, albeit with low affinity.

1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Ephrin-A1 (HY-P72662) is immobilized at 2 µg/mL (100 µL/well) can bind Human EphA1 (HY-P70321). The ED₅₀ for this effect is 17.1 ng/mL.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human Ephrin-A1 (HY-P72662) is represent at 2 µg/mL (100 µL/mL) can bind Biotinylated Recombinant Human EphA1. The ED₅₀ for this effect is 18.41 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Ephrin-A1 (HY-P72662) is immobilized at 2 µg/mL (100 µL/well) can bind Human EphA1 (HY-P70321). The ED₅₀ for this effect is 17.1 ng/mL.

Human

HEK293

C-hFc

P20827-1 (D19-S182)

1942  [NCBI]

Full Length of Mature Protein

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.