1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-13
  5. IL-13 Protein, Mouse (CHO, His)

IL-13 Protein, Mouse (CHO, His)

Cat. No.: HY-P7076A
Handling Instructions

IL-13 Protein, Mouse (CHO, His), an important CHO cell derived cytokine, is a multifunctional cytokine whose principal action is to diminish inflammatory responses.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $220 In-stock
Estimated Time of Arrival: December 31
50 μg $740 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-13 Protein, Mouse (CHO, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-13 Protein, Mouse (CHO, His), an important CHO cell derived cytokine, is a multifunctional cytokine whose principal action is to diminish inflammatory responses.

Background

Interleukin (IL)-13 plays a pivotal role in the pathogenesis of allergic asthma. Passive administration of its monoclonal antibody or soluble receptor to block overproduced IL-13 has been proven to be effective in controlling airway allergic responses in animal models, but these approaches have disadvantages of short half-lives, high costs, and possible adverse effects. IL-13 induces the gene expression of Ca2+-activating chloride channel, stimulates the differentiation of epithelial cells, and promotes mucin gene expression and release. IL-13 plays a key role in the pathogenesis of asthma[1].

Biological Activity
The ED50 is <20 ng/mL as measured by human TF-1 cells.
Species

Mouse

Source

CHO

Accession

P20109 (P22-F131)

Gene ID
Synonyms
rMuIL-13, His; P600
AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH

Molecular Weight

14-30 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-13 Protein, Mouse (CHO, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-13 Protein, Mouse (CHO, His)
Cat. No.:
HY-P7076A
Quantity:
MCE Japan Authorized Agent: