1. Recombinant Proteins
  2. IL-13 Protein, Mouse (CHO, His)

IL-13 Protein, Mouse (CHO, His)

Cat. No.: HY-P7076A
Handling Instructions

IL-13 Protein, Mouse (CHO, His), an important CHO cell derived cytokine, is a multifunctional cytokine whose principal action is to diminish inflammatory responses.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $220 In-stock
Estimated Time of Arrival: December 31
50 μg $740 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE IL-13 Protein, Mouse (CHO, His)

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-13, His; P600
Species

Mouse

Source

E. coli

Accession

P20109 (P22-F131)

Gene ID

16163

Molecular Weight

Approximately 14 kDa

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH

Biological Activity
The ED50 is <20 ng/mL as measured by human TF-1 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin (IL)-13 plays a pivotal role in the pathogenesis of allergic asthma. Passive administration of its monoclonal antibody or soluble receptor to block overproduced IL-13 has been proven to be effective in controlling airway allergic responses in animal models, but these approaches have disadvantages of short half-lives, high costs, and possible adverse effects. IL-13 induces the gene expression of Ca2+-activating chloride channel, stimulates the differentiation of epithelial cells, and promotes mucin gene expression and release. IL-13 plays a key role in the pathogenesis of asthma[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-13 Protein, Mouse (CHO, His)
Cat. No.:
HY-P7076A
Quantity:
MCE Japan Authorized Agent: