IL-13 Protein, Human (CHO)

IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation.

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent^[1].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is ≤24.04 ng/mL, corresponding to a specific activity is ≥4.20×10⁴ U/mg.

• 
  Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 6.131 ng/mL, corresponding to a specific activity is 1.63×10⁵ U/mg.

Human

CHO

Tag Free

P35225 (S33-N146)

3596  [NCBI]

Partial

SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Approximately 10-25 kDa under reduced (R) conditions, 25-45 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12(2):239-48.  [Content Brief]