Copy Link Print Information

IL-13 Protein, Human (CHO)

10 Cited Publications
Customer Review

Based on 10 publication(s) in Google Scholar

IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • IL-13 Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1].

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is ≤24.04 ng/mL, corresponding to a specific activity is ≥4.20×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 6.131 ng/mL, corresponding to a specific activity is 1.63×105 U/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P35225 (S33-N146)

  • Gene ID
    3596  [NCBI]
  • Protein Length

    Partial

  • Synonyms

    IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788

  • AA Sequence

    SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

  • Molecular Weight

    Approximately 10-25 kDa under reduced (R) conditions, 25-45 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12(2):239-48. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 6.131 ng/mL, corresponding to a specific activity is 1.63×105 U/mg.

  • 1/16

    IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Tissue Cell. 2025 Aug:95:102898. [Abstract]

    Customer Validation
     Cell viability of human nasal epithelial cell line (JME/CF15) in the control group, interleukin (IL)-13 group and IL-13 (10 ng/mL, 30 min) + PX-478 group (CCK-8 assay).

  • 1/16

    IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Tissue Cell. 2025 Aug:95:102898. [Abstract]

    Customer Validation
     Expression of ZO-1 in JME/CF15 cells in the control group, IL-13 group and IL-13 (10 ng/mL, 30 min) + PX-478 group (immunofluorescence assay).

  • 1/16

    IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2021 Dec;24(6):832. [Abstract]

    Customer Validation
     The concentration of histamine in JME/CF15 cells stimulated with IL-13 (10 ng/mL) treated with 0, 0.1, 1 or 10 µM mangiferin was detected by ELISA.

  • 1/16

    IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2021 Dec;24(6):832. [Abstract]

    Customer Validation
     The relative expression levels of Cox-2 and p-NF-κB p65/NF-κB p65 in JME/CF15 cells stimulated with IL-13 (10 ng/mL) treated with 0, 0.1, 1 or 10 µM mangiferin were detected by Western blotting.

  • 1/16

    IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2021 Dec;24(6):832. [Abstract]

    Customer Validation
     The fluorescence intensity of MUC5AC in JME/CF15 cells treated with the control group, IL-13 (10 ng/mL), or IL-13 + mangiferin (10 µM) was detected by immunofluorescence. MUC5AC was displayed as green fluorescence.

  • IL-13 Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • Experimental Validation Results for IL-13 Protein, Human (CHO)
  • IL-13 Protein, Human (CHO) Product Image

  • IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Tissue Cell. 2025 Aug:95:102898. [Abstract]

    Cell viability of human nasal epithelial cell line (JME/CF15) in the control group, interleukin (IL)-13 group and IL-13 (10 ng/mL, 30 min) + PX-478 group (CCK-8 assay).

  • IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Tissue Cell. 2025 Aug:95:102898. [Abstract]

    Expression of ZO-1 in JME/CF15 cells in the control group, IL-13 group and IL-13 (10 ng/mL, 30 min) + PX-478 group (immunofluorescence assay).

  • IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2021 Dec;24(6):832. [Abstract]

    The concentration of histamine in JME/CF15 cells stimulated with IL-13 (10 ng/mL) treated with 0, 0.1, 1 or 10 µM mangiferin was detected by ELISA.

  • IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2021 Dec;24(6):832. [Abstract]

    The relative expression levels of Cox-2 and p-NF-κB p65/NF-κB p65 in JME/CF15 cells stimulated with IL-13 (10 ng/mL) treated with 0, 0.1, 1 or 10 µM mangiferin were detected by Western blotting.

  • IL-13 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2021 Dec;24(6):832. [Abstract]

    The fluorescence intensity of MUC5AC in JME/CF15 cells treated with the control group, IL-13 (10 ng/mL), or IL-13 + mangiferin (10 µM) was detected by immunofluorescence. MUC5AC was displayed as green fluorescence.