IL-13 Protein, Cynomolgus (HEK293)
Based on 1 Customer Validation
IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.
Background
Interleukin-13 (IL-13), a pivotal cytokine, assumes crucial roles in allergic inflammation and the immune response to parasite infection. Operating synergistically with IL2, it regulates interferon-gamma synthesis and stimulates B-cell proliferation, as well as the activation of eosinophils, basophils, and mast cells. IL-13 plays a pivotal role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Notably, it exhibits the capacity to antagonize Th1-driven proinflammatory immune responses, downregulating the synthesis of various proinflammatory cytokines, including IL1, IL6, IL10, IL12, and TNF-alpha, through a mechanism that involves partial suppression of NF-kappa-B. Moreover, IL-13 functions on nonhematopoietic cells, such as endothelial cells, inducing vascular cell adhesion protein 1/VCAM1, which is crucial for eosinophil recruitment. The biological effects of IL-13 are mediated through its receptors, comprising the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, ultimately leading to STAT6 activation. Additionally, another receptor, IL13RA2, acts as a high-affinity decoy for IL-13, mediating internalization and depletion of extracellular IL-13. The cytokine interacts with IL13RA2, further adding to its intricate regulatory network[1][2][3][4][5].
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED50 is typically 1-8 ng/mL.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag Tag Free
-
Accession
ABG75889.1 (S21-N132)
-
Molecular Construction
-
N-term
-
IL-13 (S21-N132)
Accession # ABG75889.1 -
C-term
-
-
Protein Length
Full Length of Interleukin-13 Chain
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN
-
Predicted Molecular Mass
12.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)