IL-13 Protein, Human (HEK293, mFc)
Based on 1 Customer Validation
IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.
Background
Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1].
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells The ED50 for this effect is 349.05-615.42 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
AAK53823.1 (G21-N132)
-
Molecular Construction
-
N-term
-
IL-13 (G21-N132)
Accession # AAK53823.1 -
mFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
-
Predicted Molecular Mass
38.7 kDa
-
Molecular Weight
Approximately 38-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
