IL-13 Protein, Cynomolgus (HEK293, His)
IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with N-His labeled tag.
Background
Interleukin-13 (IL-13), a pivotal cytokine, assumes crucial roles in allergic inflammation and the immune response to parasite infection. Operating synergistically with IL2, it regulates interferon-gamma synthesis and stimulates B-cell proliferation, as well as the activation of eosinophils, basophils, and mast cells. IL-13 plays a pivotal role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Notably, it exhibits the capacity to antagonize Th1-driven proinflammatory immune responses, downregulating the synthesis of various proinflammatory cytokines, including IL1, IL6, IL10, IL12, and TNF-alpha, through a mechanism that involves partial suppression of NF-kappa-B. Moreover, IL-13 functions on nonhematopoietic cells, such as endothelial cells, inducing vascular cell adhesion protein 1/VCAM1, which is crucial for eosinophil recruitment. The biological effects of IL-13 are mediated through its receptors, comprising the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, ultimately leading to STAT6 activation. Additionally, another receptor, IL13RA2, acts as a high-affinity decoy for IL-13, mediating internalization and depletion of extracellular IL-13. The cytokine interacts with IL13RA2, further adding to its intricate regulatory network[1][2][3][4][5].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-His
-
Accession
ABG75889.1 (S21-N132)
-
Molecular Construction
-
N-term
-
His
-
IL-13 (S21-N132)
Accession # ABG75889.1 -
C-term
-
-
Protein Length
Full Length of Interleukin-13 Chain
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Minty A, et al. Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses. Nature. 1993 Mar 18;362(6417):248-50. [Content Brief]
[2]. Defrance T, et al. Interleukin 13 is a B cell stimulating factor. J Exp Med. 1994 Jan 1;179(1):135-43. [Content Brief]
[3]. Schnyder B, et al. Interleukin-4 (IL-4) and IL-13 bind to a shared heterodimeric complex on endothelial cells mediating vascular cell adhesion molecule-1 induction in the absence of the common gamma chain. Blood. 1996 May 15;87(10):4286-95. [Content Brief]
[4]. Miloux B, et al. Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex. FEBS Lett. 1997 Jan 20;401(2-3):163-6. [Content Brief]
[5]. Kasaian MT, et al. IL-13 antibodies influence IL-13 clearance in humans by modulating scavenger activity of IL-13Rα2. J Immunol. 2011 Jul 1;187(1):561-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)