IL-13 Protein, Cynomolgus (HEK293, His)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with N-His labeled tag.

Background

Interleukin-13 (IL-13), a pivotal cytokine, assumes crucial roles in allergic inflammation and the immune response to parasite infection. Operating synergistically with IL2, it regulates interferon-gamma synthesis and stimulates B-cell proliferation, as well as the activation of eosinophils, basophils, and mast cells. IL-13 plays a pivotal role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Notably, it exhibits the capacity to antagonize Th1-driven proinflammatory immune responses, downregulating the synthesis of various proinflammatory cytokines, including IL1, IL6, IL10, IL12, and TNF-alpha, through a mechanism that involves partial suppression of NF-kappa-B. Moreover, IL-13 functions on nonhematopoietic cells, such as endothelial cells, inducing vascular cell adhesion protein 1/VCAM1, which is crucial for eosinophil recruitment. The biological effects of IL-13 are mediated through its receptors, comprising the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, ultimately leading to STAT6 activation. Additionally, another receptor, IL13RA2, acts as a high-affinity decoy for IL-13, mediating internalization and depletion of extracellular IL-13. The cytokine interacts with IL13RA2, further adding to its intricate regulatory network[1][2][3][4][5].

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • IL-13 (S21-N132)
      Accession # ABG75889.1
    • C-term
  • Protein Length

    Full Length of Interleukin-13 Chain

  • Synonyms

    IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788

  • AA Sequence

    SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

  • Predicted Molecular Mass

    14.5 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00