2. Infection

Infection

Infection

Related Products

PDF 70.44 MB

Infection is a pathophysiological process that involves the invasion and colonization of a living organism (host) by disease-causing infectious agents, the reaction of host tissues to these agents and the toxins they produce, and the transmission of infectious agents to other hosts. Common infectious agents include viruses, viroids, prions, bacteria, nematodes, arthropods, and other macroparasites such as tapeworms. Hosts can fight infections using their immune system. Mammals often engage both innate and adaptive immune systems to eliminate infectious agents or inhibit their growth and transmission. When infection occurs, anti-infective drugs can suppress the infection. Several broad types of anti-infective drugs exist, depending on the type of organism targeted; they include antibacterial (antibiotic), antiviral, antifungal and antiparasitic agents.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-P0261
    Indolicidin 140896-21-5 99.61%
    Indolicidin is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
    Indolicidin
  • HY-P0282
    TAT peptide 98%
    TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1.
    TAT peptide
  • HY-P0302
    HEX3 688805-40-5 99.74%
    HEX3 is a fragment of the adenoviral hexon. Hexon is the major capsid protein of adenovirion and is comprised of three identical polypeptide chains.
    HEX3
  • HY-P0324
    Parasin I 219552-69-9 98%
    Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
    Parasin I
  • HY-P1104
    FC131 606968-52-9 98%
    FC131 is a potent CXCR4 antagonist. FC131 inhibits [125I]-SDF-1 binding to CXCR4 with an IC50 of 4.5 nM. FC131 has anti-HIV activity.
    FC131
  • HY-P1180
    Pam3CSK4 112208-00-1 98%
    Pam3CSK4 is a toll-like receptor 1/2 (TLR1/2) agonist with an EC50 of 0.47 ng/mL for human TLR1/2.
    Pam3CSK4
  • HY-P1358
    Alisporivir intermediate-1 882506-05-0 98.06%
    Alisporivir intermediate-1 is an intermediate in the synthesis of Alisporivir. Alisporivir is used for the treatment of inflammatory and viral diseases.
    Alisporivir intermediate-1
  • HY-P1513
    LL-37 scrambled peptide 98%
    LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
    LL-37 scrambled peptide
  • HY-P1580
    PA (224-233), Influenza 271573-27-4 98%
    PA (224-233), Influenza is a 10-aa peptide, a fragment of polymerase 2 protein in influenza A virus.
    PA (224-233), Influenza
  • HY-P1581
    Ceratotoxin A 150671-04-8 99.61%
    Ceratotoxin A, a 29-residue peptide isolated from the accessory gland secretion fluid, with strong anti-bacterial activity.
    Ceratotoxin A
  • HY-P1695
    Cinnamycin 110655-58-8 98.4%
    Cinnamycin (Ro 09-0198) is a tetracyclic peptide antibiotic that binds specifically to phosphatidylethanolamine (PE) .
    Cinnamycin
  • HY-P1758
    IFN-α Receptor Recognition Peptide 1 153840-64-3 98%
    IFN-α Receptor Recognition Peptide 1 (IRRP1) is an amino acid synthetic peptide and also a regulator of IFN-α Receptor. IFN-α Receptor Recognition Peptide 1 binds to IFNAR2, enhances the binding capacity of IFN-α receptor, and slightly increases the IFN-α-induced growth inhibitory activity. IFN-α Receptor Recognition Peptide 1 inhibits IFN-α-induced STAT1 phosphorylation and STAT-DNA binding by blocking the activation of IFNAR by IFN-α. IFN-α Receptor Recognition Peptide 1 increases the occupancy of IFN-α on cell surface receptors, enhances the phosphorylation activation of ISGF3, and elevates IFN-α-induced antiviral activity. IFN-α Receptor Recognition Peptide 1 can be used in studies related to encephalomyocarditis virus infection.
    IFN-α Receptor Recognition Peptide 1
  • HY-P1837
    Influenza HA (518-526) 186302-15-8 98.28%
    Influenza HA (518-526) is an H-2d-restricted CTL epitope derived from influenza virus hemagglutinin. Influenza HA (518-526) is highly conserved across various H5N1, some H9N2, and H1N1 strains. Influenza HA (518-526) binds to the mouse MHC class I allele Kd to form a complex, which is then recognized by specific CD8+ T cells. Influenza HA (518-526) is an immunodominant epitope in influenza-infected BALB/c mice, and it stimulates CD8+ T cells to secrete IFN-γ to induce a robust immune response. Currently, Influenza HA (518-526) is widely used in research related to respiratory syncytial virus (RSV), influenza virus, and H5N1 influenza.
    Influenza HA (518-526)
  • HY-P1896
    Hsp70-derived octapeptide 736171-62-3 98.01%
    Hsp70-derived octapeptide is a conserved octapeptide of the C-terminal end of Hsp70, which physically interacts with tetratricopeptide repeat (TPR) motifs.
    Hsp70-derived octapeptide
  • HY-P2145
    Extracellular death factor 960129-66-2 98.01%
    Extracellular death factor (EDF) is the only single signaling molecule involved in Escherichia coli quorum sensing, and can initiate MAZEF-mediated cell death. Extracellular death factor significantly amplifies the endoribonucleolytic activities of both MazF and ChpBK.
    Extracellular death factor
  • HY-P2936
    Sphingomyelin phosphodiesterase, Streptomyces sp. 9031-54-3
    Sphingomyelin phosphodiesterase, Streptomyces sp. is a sphingomyelin phosphodiesterase derived from the genus Streptomyces, which cleaves the phosphodiester bond of sphingomyelin. Sphingomyelin phosphodiesterase, Streptomyces sp. catalyzes the hydrolysis of sphingomyelin in micelles, synthetic substrates, erythrocyte ghost membranes and liposomes, as well as the hydrolysis of the substrate HNP. In the presence of Mg2+ or Mn2+ , Sphingomyelin phosphodiesterase, Streptomyces sp. induces hemolysis of bovine erythrocytes through the hydrolysis of membrane sphingomyelin.
    Sphingomyelin phosphodiesterase, Streptomyces sp.
  • HY-P2998
    β-Lactamase 9073-60-3
    β-Lactamase is the enzyme produced by bacteria. β-Lactamase mediates β-lactam resistance.
    β-Lactamase
  • HY-P3078
    Amphomycin 1402-82-0
    Amphomycin is a lipopeptide antibiotic that inhibits peptidoglycan synthesis and blocks cell wall development. Amphomycin exhibits potent antibacterial activities against methicillin-resistant S. aureus (MRSA), vancomycin-resistant enterococci (VRE), penicillin-gentamicin-erythromycin-resistant S. pneumonia, and linezolid-quinupristin-dalfopristin-resistant enterococci.
    Amphomycin
  • HY-P3141
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • HY-P3361
    IDR-1018 1453221-07-2 98%
    IDR-1018 is an innate defense regulator conjugate, with MICs of 16 μg/mL for MRSA USA300 LAC, MRSA SAP 0017 and S. epidermidis ATCC14990. IDR-1018 can be used to synthesis V-IDR1018 (vancomycin-innate defense regulator conjugate).
    IDR-1018
Cat. No. Product Name / Synonyms Application Reactivity