1. PI3K/Akt/mTOR Stem Cell/Wnt MAPK/ERK Pathway TGF-beta/Smad
  2. Akt Gli JNK PKA
  3. Adropin (34-76) (human, mouse, rat)

Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

Adropin (34-76) (human, mouse, rat)

Adropin (34-76) (human, mouse, rat) 화학구조

CAS No. : 1802086-30-1

사이즈 가격 재고 수량
1 mg 해외재고보유
5 mg 해외재고보유
10 mg 해외재고보유
25 mg 해외재고보유
50 mg   견적 받기  
100 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

고객리뷰

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Adropin (34-76) (human, mouse, rat)

View All Akt Isoform Specific Products:

View All JNK Isoform Specific Products:

View All PKA Isoform Specific Products:

  • Biological Activity

  • 순도&문서

  • References

  • 고객리뷰

제품 설명

Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway[1][2].

In Vitro

Adropin (34-76) (100 nM; 3 h) inhibits glucose production in primary cultured mouse hepatocytes[1].
Adropin (34-76) (100 nM; 3 h) decreases cAMP levels in HepG2 hepatocytes[1].
Adropin (34-76) (0-100 ng/mL; 48 h) inhibits TGF-β-induced cell activation, collagen production and fibrotic remodeling in fibroblasts[2].
Adropin (34-76) (100 ng/mL; 48 h) plays an anti-fibrotic role in fibroblasts by inhibiting the GLI1 signaling pathway[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis [2]

Cell Line: TGF-β treated fibroblasts
Concentration: 0, 10, 50 and 100 ng/mL
Incubation Time: 48 h
Result: Reduced the levels of α-smooth muscle actin and type І collagen in a dose-dependent manner.

Immunofluorescence [2]

Cell Line: TGF-β treated fibroblasts
Concentration: 100 ng/mL
Incubation Time: 48 h
Result: Reduced GLI1 and GLI2 staining intensity but did not interfere with the nuclear translocation of GLI1 or GLI2.
In Vivo

Adropin (34-76) (450 nmol/kg ≈ 2 mg/kg; intraperitoneal injection; 5 injections within 48 hours) has a hypoglycemic effect in a diet-induced obesity model of mice[1].
Adropin (34-76) (10 μg/kg/h; subcutaneous osmotic pump; 25 days) has an improved effect in the mouse model of fibrosis[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male DIO B6 mice[1]
Dosage: 450 nmol/kg ≈ 2 mg/kg
Administration: Five intraperitoneal injections over a 48-h period
Result: Enhanced intracellular signaling actions underlying insulin’s effect on hepatic glucose metabolism.
Alleviated hepatic ER stress responses.
Diminished JNK and PKA signaling in the liver.
Down-regulates hepatic lipogenic genes.
Altered the phosphorylation levels of IP3R in the liver.
Animal Model: Mouse with fibrosis model[2]
Dosage: 10 μg/kg/h
Administration: Subcutaneous osmotic pump; 25 days
Result: Ameliorated allogeneic bone marrow transplantation (alloBMT)-induced skin fibrosis, with reduced dermal thickness, lower myofibroblast counts, and decreased hydroxyproline content.
Ameliorated alloBMT-induced pulmonary fibrosis, with reduced Ashcroft scores and hydroxyproline content.
분자량

4499.82

화학식

C190H293N55O68S2

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro (Disulfide bridge: Cys1-Cys23)

Sequence Shortening

CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP (Disulfide bridge: Cys1-Cys23)

선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

용액&용해도
In Vitro: 

DMSO : ≥ 100 mg/mL (22.22 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2222 mL 1.1112 mL 2.2223 mL
5 mM 0.0444 mL 0.2222 mL 0.4445 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • 몰농도 계산기

  • 농도 희석 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

Select the appropriate dissolution method based on your experimental animal and administration route.

For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for in vivo experiments, it is recommended to prepare freshly and use it on the same day.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  10% DMSO    40% PEG300    5% Tween-80    45% Saline

    Solubility: ≥ 2.5 mg/mL (0.56 mM); Clear solution

    This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).

    Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.

    Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
  • Protocol 2

    Add each solvent one by one:  10% DMSO    90% (20% SBE-β-CD in Saline)

    Solubility: ≥ 2.5 mg/mL (0.56 mM); Clear solution

    This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).

    Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.

    Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
%
DMSO +
+
%
Tween-80 +
%
Saline
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Calculation results:
Working solution concentration: mg/mL
Method for preparing stock solution: mg drug dissolved in μL  DMSO (Stock solution concentration: mg/mL).

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only. If necessary, please contact MedChemExpress (MCE).
Method for preparing in vivo working solution for animal experiments: Take μL DMSO stock solution, add μL . μL , mix evenly, next add μL Tween 80, mix evenly, then add μL Saline.
 If the continuous dosing period exceeds half a month, please choose this protocol carefully.
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
순도&문서
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2222 mL 1.1112 mL 2.2223 mL 5.5558 mL
5 mM 0.0444 mL 0.2222 mL 0.4445 mL 1.1112 mL
10 mM 0.0222 mL 0.1111 mL 0.2222 mL 0.5556 mL
15 mM 0.0148 mL 0.0741 mL 0.1482 mL 0.3704 mL
20 mM 0.0111 mL 0.0556 mL 0.1111 mL 0.2778 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

상품명

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Adropin (34-76) (human, mouse, rat)
Cat. No.:
HY-P4860
수량:
MCE Japan Authorized Agent: