2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  5. PD-1
  6. PD-1 Protein, Canine (HEK293, Fc)

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. PDCD1 is involved in the regulation of T-cell functions, including those of effector CD8+ T cells, PDCD1 protein can also promote the differentiation of CD4+ T cells into T regulatory cells, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, PDCD1 is involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity as the PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival[1][2].
Biological Activity

Immobilized Canine PD-1, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human PD-L1, mFc Tag with the EC50 of 67.7 ng/mL determined by ELISA

Species

Canine
Source

HEK293
Tag

C-hFc
Accession

A0A8C0LHR8/NP_001301026.1 (L25-V170)
Gene ID
Molecular Construction
N-term
PD-1 (L25-V170)
Accession # A0A8C0LHR8/NP_001301026.1
hFc
C-term
Protein Length

Partial
Synonyms
CD279; PDCD1; Programmed cell death 1; SLEB2
AA Sequence

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGLV

Molecular Weight

55-70 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US; may vary elsewhere.
Documentation
SDS (251 KB)

COA (221 KB)

Handling Instructions (2659 KB)

PD-1 Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PD-1 Protein, Canine (HEK293, Fc)

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P73341
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB) Italian - IT (251 KB) Korean - KR (251 KB) Portuguese - PT (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.