2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  5. PD-1
  6. PD-1 Protein, Canine (HEK293, Fc)

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
> 100 μg   Angebot einholen  
or Massenanfrage

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products

  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. PDCD1 is involved in the regulation of T-cell functions, including those of effector CD8+ T cells, PDCD1 protein can also promote the differentiation of CD4+ T cells into T regulatory cells, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, PDCD1 is involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity as the PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival[1][2].
Biologische Aktivität

Immobilized Canine PD-1, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human PD-L1, mFc Tag with the EC50 of 67.7 ng/mL determined by ELISA

Species

Canine
Source

HEK293
Tag

C-hFc
Accession

A0A8C0LHR8/NP_001301026.1 (L25-V170)
Gene ID
Molecular Construction
N-term
PD-1 (L25-V170)
Accession # A0A8C0LHR8/NP_001301026.1
hFc
C-term
Protein Length

Partial
Synonyms
CD279; PDCD1; Programmed cell death 1; SLEB2
AA Sequence

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGLV

Molekulargewicht

55-70 kDa
Reinheit

≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Versand

Room temperature in continental US; may vary elsewhere.
Dokumentation
SDS (251 KB)

COA (221 KB)

Handling Instructions (2659 KB)

PD-1 Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

PD-1 Protein, Canine (HEK293, Fc)

  

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

      

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
PD-1 Protein, Canine (HEK293, Fc)
Art. -Nr.:
HY-P73341
Menge:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Produktname

  

Lot #

Name des Antragstellers *

 

Country or Region *

E-Mail-Addresse *

     

Telefonnummer *

 

Name der Organisation *

Bemerkungen

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB) Italian - IT (251 KB) Korean - KR (251 KB) Portuguese - PT (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.