PD-1 Protein, Mouse (HEK293, Fc)
Based on 1 publication(s) in Google Scholar
The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
PD-1, an inhibitory receptor expressed on antigen-activated T-cells, plays a crucial role in the induction and maintenance of immune tolerance to self. Upon binding to ligands like CD274/PDCD1L1 and CD273/PDCD1LG2, PD-1 delivers inhibitory signals, suppressing T-cell activation and contributing to the regulation of immune responses. Following T-cell receptor engagement, PD-1 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. The inhibitory effects involve the recruitment of PTPN11/SHP-2, which dephosphorylates key signaling molecules proximal to the TCR. Exploited by tumors, the PD-1-mediated inhibitory pathway serves to attenuate anti-tumor immunity and promote tumor survival. PD-1 exists as a monomer and interacts with CD274/PDCD1L1 and CD273/PDCD1LG2, while interaction with FBXO38 leads to ubiquitination and proteasomal degradation.
Verified Bioactivity
1. Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 this effect is 1.974 μg/mL, corresponding to a specific activity is 5.07×10^2 units/mg.
2. Immobilized Recombinant Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1. The ED50 for this effect is 0.6932 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q02242 (L25-Q167)
-
Molecular Construction
-
N-term
-
PD-1 (L25-Q167)
Accession # Q02242 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PDCD1; Systemic Lupus Erythematosus Susceptibility 2; Prev. SLEB2; HPD-1; PD1; Programmed Cell Death 1 Protein; Programmed Cell Death Protein 1; CD279 Antigen; CD279; ADMIO4; HSLE1; AIMTBS; PD-1; HPD-L; Programmed Cell Death 1; Protein PD-1
-
AA Sequence
LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
-
Molecular Weight
Approximately 55-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
