PD-1 Protein, Mouse (HEK293, Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PD-1, an inhibitory receptor expressed on antigen-activated T-cells, plays a crucial role in the induction and maintenance of immune tolerance to self. Upon binding to ligands like CD274/PDCD1L1 and CD273/PDCD1LG2, PD-1 delivers inhibitory signals, suppressing T-cell activation and contributing to the regulation of immune responses. Following T-cell receptor engagement, PD-1 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. The inhibitory effects involve the recruitment of PTPN11/SHP-2, which dephosphorylates key signaling molecules proximal to the TCR. Exploited by tumors, the PD-1-mediated inhibitory pathway serves to attenuate anti-tumor immunity and promote tumor survival. PD-1 exists as a monomer and interacts with CD274/PDCD1L1 and CD273/PDCD1LG2, while interaction with FBXO38 leads to ubiquitination and proteasomal degradation.

Verified Bioactivity

1. Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 this effect is 1.974 μg/mL, corresponding to a specific activity is 5.07×10^2 units/mg.
2. Immobilized Recombinant Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1. The ED50 for this effect is 0.6932 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 for this effect is 1.974 μg/mL, corresponding to a specific activity is 5.07×102 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PD-1 (L25-Q167)
      Accession # Q02242
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    PDCD1; Systemic Lupus Erythematosus Susceptibility 2; Prev. SLEB2; HPD-1; PD1; Programmed Cell Death 1 Protein; Programmed Cell Death Protein 1; CD279 Antigen; CD279; ADMIO4; HSLE1; AIMTBS; PD-1; HPD-L; Programmed Cell Death 1; Protein PD-1

  • AA Sequence

    LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

  • Molecular Weight

    Approximately 55-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00