Copy Link Print Information

PD-1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

PD-1 Protein is an important immune regulatory molecule expressed on the surface of activated immune cells. By binding to its ligands (PD-L1/PD-L2), the PD-1 Protein exerts immunosuppressive effects. PD-1 Protein can be used in the research of tumors, autoimmune diseases, and other conditions. PD-1 Protein, Mouse (HEK293, His) is a recombinant PD-1 protein expressed by HEK293 cells and carries a C-6*His tag and glycosylation modification.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PD-1 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for PD-1 Protein, Mouse (HEK293, His)
  • PD-1 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PD-1 Protein is an important immune regulatory molecule expressed on the surface of activated immune cells. By binding to its ligands (PD-L1/PD-L2), the PD-1 Protein exerts immunosuppressive effects. PD-1 Protein can be used in the research of tumors, autoimmune diseases, and other conditions. PD-1 Protein, Mouse (HEK293, His) is a recombinant PD-1 protein expressed by HEK293 cells and carries a C-6*His tag and glycosylation modification[1][2].

Background

PD-1, also known as CD279, is a 55 kDa transmembrane protein consisting of 288 amino acids, including a signal peptide, extracellular domain, transmembrane domain, and intracellular domain. As an immune checkpoint molecule, PD-1 is mainly expressed on the surface of activated immune cells such as T cells and B cells. Notably, PD-1 is highly expressed on tumor-specific T cells. PD-1 acts as an inhibitor of adaptive and innate immune responses. Under normal conditions, PD-1 maintains immune tolerance by binding to its ligands PD-L1/PD-L2 to avoid autoimmune damage. However, when PD-1 binds to PD-L1/PD-L2 on tumor cells, it leads to T cell functional exhaustion, inhibits cytokine secretion, and facilitates tumor immune escape. Currently, PD-1 serves as a core target for cancer immunotherapy, and its inhibitors can restore the tumor-killing ability of T cells by blocking this binding[1][2].

Verified Bioactivity

1.Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 for this effect is <1 μg/mL.
2.Immobilized Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Biotinylated Mouse PD-L1, Fc (HY-P70633). The ED50 for this effect is <1 μg/mL.
3.Immobilized Mouse PD-1 at 1 μg/mL (100 μL/well) can bind Biotinylated Mouse PD-L1, His (HY-P70632). The ED50 for this effect is <1 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q02242 (L25-Q167)

  • Gene ID
    18566  [NCBI]
  • Molecular Construction
    • N-term
    • PD-1 (L25-Q167)
      Accession # Q02242
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    PDCD1; Systemic Lupus Erythematosus Susceptibility 2; Prev. SLEB2; HPD-1; PD1; Programmed Cell Death 1 Protein; Programmed Cell Death Protein 1; CD279 Antigen; CD279; ADMIO4; HSLE1; AIMTBS; PD-1; HPD-L; Programmed Cell Death 1; Protein PD-1

  • AA Sequence

    LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

  • Molecular Weight

    Approximately 33-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Han Y, et al. PD-1/PD-L1 pathway: current researches in cancer. Am J Cancer Res. 2020 Mar 1;10(3):727-742. [Content Brief]

[2]. Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18(12):e731-e741. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 for this effect is 0.986 μg/mL, corresponding to a specific activity is 1.01×103 units/mg.

  • PD-1 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PD-1 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for PD-1 Protein, Mouse (HEK293, His)
  • PD-1 Protein, Mouse (HEK293, His) Product Image