PD-1 Protein, Canine (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (Biotinylated, HEK293, His-Avi) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (Biotinylated, HEK293, His-Avi) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. PDCD1 is involved in the regulation of T-cell functions, including those of effector CD8+ T cells, PDCD1 protein can also promote the differentiation of CD4+ T cells into T regulatory cells, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, PDCD1 is involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity as the PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival[1][2].
Verified Bioactivity
Immobilized Recombinant Canine PD-1 Protein (AVI & His Tag), Biotinylated at 2 μg/mL (100 μl/well) on streptavidin precoated (2 μg/mL, 100 μL/well) can bind Recombinant Canine PD-L1 / B7-H1 / CD274 Protein (ECD, Fc Tag), the EC50 is ≤100 ng/mL.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
A0A8C0LHR8/NP_001301026.1 (L25-G168)
-
Molecular Construction
-
N-term
-
PD-1 (L25-G168)
Accession # A0A8C0LHR8/NP_001301026.1 -
Avi-His
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
PDCD1; Systemic Lupus Erythematosus Susceptibility 2; Prev. SLEB2; HPD-1; PD1; Programmed Cell Death 1 Protein; Programmed Cell Death Protein 1; CD279 Antigen; CD279; ADMIO4; HSLE1; AIMTBS; PD-1; HPD-L; Programmed Cell Death 1; Protein PD-1
-
AA Sequence
LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQG
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 32-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
