PD-1 Protein, Canine (Biotinylated, HEK293, His-Avi)

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (Biotinylated, HEK293, His-Avi) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. PDCD1 is involved in the regulation of T-cell functions, including those of effector CD8+ T cells, PDCD1 protein can also promote the differentiation of CD4+ T cells into T regulatory cells, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, PDCD1 is involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity as the PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival^[1][2].

Canine

HEK293

C-Avi;C-His

A0A8C0LHR8/NP_001301026.1 (L25-G168)

486213  [NCBI]

Partial

Biotin

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQG

Approximately 32-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.