PD-1 Protein, Rat (HEK293, His)

Programmed cell death protein 1 (Pdcd1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. Pdcd1plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but Pdcd1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-1 protein, expressed by HEK293 , with C-His labeled tag.

Programmed cell death 1 (Pdcd1) is an immune-inhibitory receptor expressed in activated T cells which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. Pdcd1is involved in the regulation of T-cell functions, including those of effector CD8+ T cells, PDCD1 protein can also promote the differentiation of CD4+ T cells into T regulatory cells, playing a critical role in induction and maintenance of immune tolerance to self. Pdcd1is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, Pdcd1is involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity as the Pdcd1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival^[1][2].

Immobilized Recombinant Rat PD-L1 at 1 μg/mL (100 μL/well) can bind Recombinant Rat PD-1. The ED₅₀ for this effect is 0.2756 μg/mL.

• 
  Immobilized Recombinant Rat PD-L1 at 1 μg/mL (100 μL/well) can bind Recombinant Rat PD-1. The ED₅₀ for this effect is 0.2756 μg/mL.

Rat

HEK293

C-6*His

D3ZIN8/NP_001100397.1 (L25-Q167)

301626  [NCBI]

Partial

LEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLKLNWYRLSPSNQTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGIYLCGAISLPPKAQIKESPGAELVVTERILETPTRYPRPSPKPEGQFQ

Approximately 30-40 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.