Copy Link Print Information

PD-1 Protein, Canine (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Programmed cell death protein 1 (Pdcd1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. Pdcd1plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but Pdcd1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, His, solution) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PD-1 Protein, Canine (HEK293, His, solution)
  • PD-1 Protein, Canine (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Programmed cell death protein 1 (Pdcd1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. Pdcd1plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but Pdcd1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, His, solution) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Programmed cell death 1 (Pdcd1) is an immune-inhibitory receptor expressed in activated T cells which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. Pdcd1is involved in the regulation of T-cell functions, including those of effector CD8+ T cells, PDCD1 protein can also promote the differentiation of CD4+ T cells into T regulatory cells, playing a critical role in induction and maintenance of immune tolerance to self. Pdcd1is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, Pdcd1is involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity as the Pdcd1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival.

Verified Bioactivity

Measured by its ability to bind biotinylated human B7-H1-Fc in functional ELISA.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-His
  • Accession

    XP_543338.3 (L25-L169)

  • Gene ID
    486213  [NCBI]
  • Molecular Construction
    • N-term
    • PD-1 (L25-L169)
      Accession # XP_543338.3
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDCD1; Systemic Lupus Erythematosus Susceptibility 2; Prev. SLEB2; HPD-1; PD1; Programmed Cell Death 1 Protein; Programmed Cell Death Protein 1; CD279 Antigen; CD279; ADMIO4; HSLE1; AIMTBS; PD-1; HPD-L; Programmed Cell Death 1; Protein PD-1

  • AA Sequence

    LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVMRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGL

  • Predicted Molecular Mass

    17.7 kDa

  • Molecular Weight

    Approximately 35 kDa & 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.;≥ 95%, as determined by HPLC.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • PD-1 Protein, Canine (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for PD-1 Protein, Canine (HEK293, His, solution)
  • PD-1 Protein, Canine (HEK293, His, solution) Product Image