1. Search Result
Search Result
Results for "

CCR5 antagonist

" in MedChemExpress (MCE) Product Catalog:

47

Inhibitors & Agonists

2

Peptides

1

Inhibitory Antibodies

1

Natural
Products

1

Isotope-Labeled Compounds

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-13004
    Maraviroc
    Maximum Cited Publications
    51 Publications Verification

    UK-427857

    CCR HIV Inflammation/Immunology Endocrinology Cancer
    Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
    Maraviroc
  • HY-14882
    Cenicriviroc
    5+ Cited Publications

    TAK-652; TBR-652

    CCR HIV Infection Endocrinology
    Cenicriviroc (TAK-652) is an orally active, dual CCR2/CCR5 antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity .
    Cenicriviroc
  • HY-12080
    BX471
    20+ Cited Publications

    ZK-811752

    CCR Inflammation/Immunology Endocrinology
    BX471 (ZK-811752) is an orally active, potent and selective non-peptide CCR1 antagonist with a Ki of 1 nM, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
    BX471
  • HY-13406
    TAK-779
    10+ Cited Publications

    Takeda 779

    CCR HIV CXCR Infection Inflammation/Immunology Endocrinology
    TAK-779 is a potent and selective nonpeptide antagonist of CCR5 and CXCR3, with a Ki of 1.1 nM for CCR5, and effectively and selectively inhibits R5 HIV-1, with EC50 and EC90 of 1.2 nM and 5.7 nM, respectively, in MAGI-CCR5 cells.
    TAK-779
  • HY-109593
    BMS-813160
    1 Publications Verification

    CCR Cardiovascular Disease Inflammation/Immunology Endocrinology Cancer
    BMS-813160 is a potent and selective CCR2/5 dual antagonist. BMS-813160 binds with CCR2 and CCR5 with IC50s of 6.2 and 3.6 nM, respectively. BMS-813160 can be used for the research of inflammation .
    BMS-813160
  • HY-14882A
    Cenicriviroc Mesylate
    5+ Cited Publications

    TAK-652 Mesylate; TBR-652 Mesylate

    CCR HIV Infection Inflammation/Immunology Endocrinology
    Cenicriviroc Mesylate (TAK-652 Mesylate) is a dual CCR2/CCR5 antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity.
    Cenicriviroc Mesylate
  • HY-12080A
    BX471 hydrochloride
    20+ Cited Publications

    ZK-811752 hydrochloride

    CCR Inflammation/Immunology Endocrinology
    BX471 hydrochloride (ZK-811752 hydrochloride) is a potent, selective non-peptide CCR1 antagonist with Ki of 1 nM for human CCR1, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
    BX471 hydrochloride
  • HY-17450A

    AK602 hydrochloride; GSK-873140 hydrochloride; GW-873140 hydrochloride

    CCR HIV Infection
    Aplaviroc (AK 602) hydrochloride, a SDP derivative, is a CCR5 antagonist, with IC50s of 0.1-0.4 nM for HIV-1Ba-L, HIV-1JRFL and HIV-1MOKW.
    Aplaviroc hydrochloride
  • HY-15971A
    AMD 3465
    5 Publications Verification

    GENZ-644494

    CXCR HIV Infection Endocrinology
    AMD 3465 (GENZ-644494) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12 AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465
  • HY-17377

    SCH-417690 maleate; SCH-D maleate

    CCR HIV Infection Endocrinology Cancer
    Vicriviroc maleate (SCH-417690 maleate; SCH-D maleate) is a potent, selective, oral bioavailable and CNS penetrated antagonist of CCR5, with a Ki of 2.5 nM, and also inhibits HIV-1 in PBMC cells, with IC90s of 3.3 nM (JrFL), 2.8 nM (ADA-M), 1.8 nM (301657), 4.9 nM (JV1083) and 10 nM (RU 570).
    Vicriviroc maleate
  • HY-D0976
    NF279
    1 Publications Verification

    P2X Receptor HIV NTPDase CXCR Infection
    NF279 is a selective P2X1 receptor antagonist and NTPDase inhibitor, with a P2X1 IC50 value of 19 nM. NF279 suppresses GABA-evoked currents, reduces ATP-excited respiratory activity, alters hypoglossal nerve burst parameters, and blocks CXCR4, CCR5, CXCR3, and CXCR7-mediated calcium responses. NF279 arrests HIV-1 fusion downstream of CD4 binding, inhibits R5- and X4-tropic HIV-1 strains. NF279 can be used for the research of HIV-1 infection .
    NF279
  • HY-15971
    AMD 3465 hexahydrobromide
    5 Publications Verification

    GENZ-644494 hexahydrobromide

    CXCR HIV Infection Endocrinology
    AMD 3465 hexahydrobromide (GENZ-644494 hexahydrobromide) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12 AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465 hexahydrobromide
  • HY-103360
    J-113863
    3 Publications Verification

    CCR Inflammation/Immunology
    J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .
    J-113863
  • HY-19974
    TAK-220
    3 Publications Verification

    CCR HIV Infection Endocrinology
    TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
    TAK-220
  • HY-111069

    CCR HIV Infection Inflammation/Immunology
    Nifeviroc is an orally active CCR5 antagonist. Nifeviroc is used for the study of HIV type-1 infection .
    Nifeviroc
  • HY-152132

    CCR HIV Infection
    CCR5 antagonist 3 (Compound 26) is a CCR5 antagonist with an IC50 of 15.90 nM. CCR5 antagonist 3 shows broad-spectrum anti-HIV-1 activities .
    CCR5 antagonist 3
  • HY-100261

    CCR HIV Infection Endocrinology
    CCR5 antagonist 1 is a CCR5 antagonist which can inhibit HIV replication extracted from WO 2004054974 A2.
    CCR5 antagonist 1
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-107401

    SCH-351125

    HIV CCR Calcium Channel Infection
    Ancriviroc (SCH-351125) is an orally active CCR5 antagonist with an IC50 value of 13 nM against hCCR5. Ancriviroc specifically binds to hCCR5, blocks ligand-induced signal transduction, calcium influx, GTPγS binding, chemotaxis, ligand binding, and HIV-1 entry, induces conformational changes in CCR5, and inhibits infection and replication of R5-tropic HIV-1 .
    Ancriviroc
  • HY-139184

    CCR Inflammation/Immunology
    CCR5 antagonist 4 is an orally active CCR5 antagonist. CCR5 antagonist 4 can be studied in research on rheumatoid arthritis .
    CCR5 antagonist 4
  • HY-152131

    CCR HIV Infection
    CCR5 antagonist 2 (Compound 25) is a CCR5 antagonist with an IC50 of 8.34 nM. CCR5 antagonist 2 shows broad-spectrum anti-HIV-1 activities .
    CCR5 antagonist 2
  • HY-119101
    AZD-5672
    1 Publications Verification

    CCR Potassium Channel P-glycoprotein Inflammation/Immunology
    AZD-5672 is an orally active, potent, and selective CCR5 antagonist (IC50=0.32 nM). AZD-5672 shows moderate activity against the hERG ion channel (binding IC50=7.3 μM). AZD5672 is a substrate of human P-gp, and inhibits P-gp-mediated digoxin transport (IC50=32 μM). AZD-5672 can be used for the research of rheumatoid arthritis .
    AZD-5672
  • HY-111321

    Oxidative Phosphorylation CCR HIV Bacterial Mitochondrial Metabolism Endogenous Metabolite Infection Metabolic Disease
    Fuscin, a fungal metabolite, CCR5 receptor antagonist with anti-HIV effects. Fuscin is a respiration and oxidative phosphorylation inhibitor, and also a mitochondrial SH-dependent transport-linked functions inhibitor .
    Fuscin
  • HY-117621

    CCR Metabolic Disease
    PF-0463481 is a potent and orally active dual CCR2/CCR5 antagonist with comparable human and rodent CCR2 potency (rat IC50=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC50=470 nM). PF-0463481 is safe and well-tolerated and has the potential for the study of diabetic nephropathy .
    PF-04634817
  • HY-117621A

    CCR Metabolic Disease
    PF-0463481 succinate is a potent and orally active dual CCR2/CCR5 antagonist with comparable human and rodent CCR2 potency (rat IC50=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC50=470 nM). PF-0463481 succinate is safe and well-tolerated and has the potential for the study of diabetic nephropathy .
    PF-04634817 succinate
  • HY-14231

    CCR Infection Inflammation/Immunology
    CCR5 antagonist 5 (compound example 11) is a CCR5 antagonist. CCR5 antagonist 5 has the potential to study inflammation and immunity and viral (such as HIV) infection .
    CCR5 antagonist 5
  • HY-14388

    CCR HIV Infection
    PF-232798 is an orally active CCR5 antagonist with anti-HIV effects .
    PF-232798
  • HY-13004S

    Isotope-Labeled Compounds CCR HIV Inflammation/Immunology Endocrinology Cancer
    Maraviroc-d6 (UK-427857-d6) is the deuterium labeled Maraviroc. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV .
    Maraviroc-d6
  • HY-17450

    AK 602; GSK 873140; GW 873140

    CCR HIV Infection Endocrinology
    Aplaviroc (AK 602), a SDP derivative, is a CCR5 antagonist, with IC50s of 0.1-0.4 nM for HIV-1Ba-L, HIV-1JRFL and HIV-1MOKW.
    Aplaviroc
  • HY-P991541

    CCR HIV Infection
    HGS101 is a fully human CCR5 monoclonal antibody with high affinity to CCR5. HGS101 binds to the 2nd extracellular loop (ECL-2) and acts as a signal antagonist. HGS101 restores Maraviroc (HY-13004) inhibition of Maraviroc-resistant HIV-1 infection of PBMCs. HGS101 shows anti-HIV activity by inhibiting CCR5 signaling in simian immunodeficiency virus-uninfected RMs models .
    HGS101
  • HY-14230

    CCR HIV Infection
    INCB9471 is a potent, selective and orally active CCR5 antagonist. INCB9471 shows anti-HIV-1 activity .
    INCB9471
  • HY-13004R

    UK-427857 (Standard)

    Reference Standards CCR HIV Inflammation/Immunology Endocrinology Cancer
    Maraviroc (Standard) is the analytical standard of Maraviroc. This product is intended for research and analytical applications. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
    Maraviroc (Standard)
  • HY-108432

    CCR Inflammation/Immunology
    BMS-741672 is a selective and orally active CCR2 antagonist with an IC50 of 1.1 nM. BMS-741672 shows >700-fold selective for CCR2 than CCR5 .
    BMS-741672
  • HY-14882R

    TAK-652 (Standard); TBR-652 (Standard)

    CCR HIV Reference Standards Infection Endocrinology
    Cenicriviroc (Standard) is the analytical standard of Cenicriviroc. This product is intended for research and analytical applications. Cenicriviroc (TAK-652) is an orally active, dual CCR2/CCR5 antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity .
    Cenicriviroc (Standard)
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-123768

    AD-101

    CCR Infection
    SCH 350581 (AD-101) is a CCR5 antagonist. SCH 350581 inhibits HIV-1 replication, viral entry into cells, and the binding of gp120 to cell lines in primary lymphocytes .
    SCH 350581
  • HY-15971AR

    GENZ-644494 (Standard)

    CXCR HIV Reference Standards Infection Endocrinology
    AMD 3465 (Standard) is the analytical standard of AMD 3465. This product is intended for research and analytical applications. AMD 3465 (GENZ-644494) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465 (Standard)
  • HY-B0155

    SCH 417690; SCH-D; MK-7690 free base

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc
  • HY-15971R

    GENZ-644494 hexahydrobromide (Standard)

    CXCR HIV Reference Standards Infection Endocrinology
    AMD 3465 (hexahydrobromide) (Standard) is the analytical standard of AMD 3465 (hexahydrobromide). This product is intended for research and analytical applications. AMD 3465 hexahydrobromide (GENZ-644494 hexahydrobromide) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12AF647 to CXCR4, with IC50s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC50: 1-10 nM), but has no effect on CCR5-using (R5) viruses.
    AMD 3465 hexahydrobromide (Standard)
  • HY-118962

    CCR HIV Infection
    E913 is a CCR5 antagonist that competes with the binding of antibodies to CCR5 which recognize the C-terminal half of the second extracellular loop (ECL2B) of CCR5. E913 can specifically block the binding of macrophage inflammatory protein-1alpha (MIP-1alpha) to CCR5 (IC50 = 0.002 μM) and MIP-1alpha-elicited cellular Ca 2+ mobilization (IC50 = 0.02 μM). E913 inhibits the replication of laboratory and primary R5 HIV-1 strains as well as various multidrug-resistant monocyte/macrophage tropic (R5) HIV-1 (IC50 = 0.03-0.06 μM). E913 can be used for the research of infection, such as HIV-1 infection .
    E913
  • HY-100584R

    Erythromycin Cyclocarbonate (Standard)

    Reference Standards Bacterial Antibiotic Infection
    Maraviroc (Standard) is the analytical standard of Maraviroc. This product is intended for research and analytical applications. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
    Davercin (Standard)
  • HY-123884

    CCR HIV Infection
    GSK-214096 is a selective CCR5 antagonist and an inhibitor of HIV-1 entry. GSK-214096 inhibits HIV-1 glycoprotein 120 (gp120) .
    GSK-214096
  • HY-119658

    INCB10820

    CCR Inflammation/Immunology
    PF-4178903 (INCB10820) is an orally active, potent dual CCR2 and CCR5 antagonist with IC50 values of 3 nM and 5.3 nM, respectively. PF-4178903 is promising for research of chronic inflammatory and autoimmune diseases .
    PF-4178903
  • HY-12944

    HIV CCR Infection
    GSK163929 (compound 122) is an orally active, anti-HIV CCR5 antagonist with low inhibitory potency against hEGR. GSK163929 had no adverse effects in rats at 2000 mg/kg/day (i.v., 7 d) and in dogs at 250 mg/kg/day (i.v., 7 d) .
    GSK163929
  • HY-179607

    CCR Inflammation/Immunology Cancer
    LUF8100 is a dual-target antagonist of CCR2/CCR5 with pKi values for CCR2 and CCR5 of 5.23 and 4.97 respectively. LUF8100 can be used for research on immune homeostasis and cancer .
    LUF8100
  • HY-B0155B

    SCH 417690 malate; SCH-D malate; MK-7690

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc malate
  • HY-103360R

    Reference Standards CCR Inflammation/Immunology
    J-113863 (Standard) is the analytical standard of J-113863 (HY-103360). This product is intended for research and analytical applications. J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .
    J-113863 (Standard)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: