1. GPCR/G Protein Stem Cell/Wnt MAPK/ERK Pathway JAK/STAT Signaling Protein Tyrosine Kinase/RTK Metabolic Enzyme/Protease Immunology/Inflammation NF-κB Neuronal Signaling Membrane Transporter/Ion Channel
  2. PACAP Receptor ERK EGFR Reactive Oxygen Species (ROS) Calcium Channel
  3. PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat  (Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 38)

Cat. No.: HY-P0221 Pureza: 99.99%
Instrucciones de manejo Technical Support

PACAP (1-38), human, ovine, rat is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat increases the α-secretase activity. PACAP (1-38), human, ovine, rat elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat can be used for neurotrophic and neuroprotective research.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

No. CAS : 137061-48-4

Tamaño Precio Stock Cantidad
500 μg En stock
1 mg En stock
5 mg En stock
10 mg   Obtener un presupuesto  
50 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Revisión del cliente

Based on 5 publication(s) in Google Scholar

Other Forms of PACAP (1-38), human, ovine, rat:

Top Publications Citing Use of Products

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49.  [Abstract]

    Latency to eat and food consumption in NSF at 30 min post-PACAP (1-38) (0.4, 2.0, 4.0 ng/site; administrated intrahippocampally in a volume of 0.2 μL) [F (3, 28) = 5.940, P = 0.0029; F (3, 28) = 14.16, P < 0.0001]. The results showed that 30 minutes after the administration of low and medium doses of PACAP (1-38), a shortened feeding latency and increased food intake were observed in the Novelty Suppressed Feeding (NSF) paradigm.

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49.  [Abstract]

    Immobility time in FST at 7 d post-PACAP (1-38) [F (3, 28) = 3.415, P = 0.0309] (n = 8). One-way ANOVA, *P < 0.05, **P < 0.01, ***P < 0.001. The immediate and lasting antidepressant activity with the infusion of 0.4 ng/site of hippocampal PACAP (1-38) (administrated intrahippocampally in a volume of 0.2 μL) in mice subjected to chronic mild stress (CMS).

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2023 Aug 8;21(1):261.  [Abstract]

    Colocalization of CY5.5-PACAP (4 h), CY3-HA NGs in HA NGs@exosomes from primary neuronal cells by fluorescent microscopy. Scale bar: 50 μm. Immunofluorescence staining showed the co-localization of PACAP (1-38) (200 µg/mL; overnight) and HA nanogels, indicating the successful encapsulation of PACAP (1-38) into HA NGs@exosomes in primary neuronal cells.

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705.  [Abstract]

    SCs were treated with various concentrations of PACAP (1-38) (PACAP, 1-100 nM) for 48 h and then FGF17, CTSS and MMP‐12 expression was measured by western blotting. Western blotting showed that PACAP (1-38) (rPACAP) induced expression of FGF17, CTSS and MMP‐12 in SCs.

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705.  [Abstract]

    Volcano plot of DEGs in SCs after PACAP (1-38) (100 nM; 48 h) treatment. Analysis of upregulated DEGs induced by PACAP (1-38) showed that fibroblast growth factor 17 (FGF17) expression was significantly upregulated in the treatment group (log2 fold‐change = 2.89, p = 0.0019).

    Ver todos los productos específicos de isoformas PACAP Receptor:

    Ver todos los productos específicos de isoformas ERK:

    Ver todos los productos específicos de isoformas EGFR:

    Ver todos los productos específicos de isoformas Calcium Channel:

    • Actividad biológica

    • Pureza y Documentación

    • Referencias

    • Revisión del cliente

    Descripciòn

    PACAP (1-38), human, ovine, rat is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat increases the α-secretase activity. PACAP (1-38), human, ovine, rat elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat can be used for neurotrophic and neuroprotective research[1][2][3][4][5][6][7].

    IC50 & Target

    IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP1), and 1 nM (PACAP type II receptor VIP2)[1]

    In Vitro

    PACAP (1-38), human, ovine, rat is a fragment of pituitary adenylate cyclase activating polypeptide[1].
    PACAP (1-38), human, ovine, rat shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2].
    In vitro, PACAP (1-38), human, ovine, rat relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].
    PACAP (1-38), human, ovine, rat (100 nM; 2 min; NCI-H838 cells) induces EGFR, HER2 and ERK tyrosine phosphorylation[5].
    PACAP (1-38), human, ovine, rat (100 nM; 30 min; NCI-H838 cells) induces EGFR tyrosine phosphorylation with generates ROS and increases ROS levels by 51%[5].
    PACAP (1-38), human, ovine, rat (10 nM; 48 h) stimulates the growth of NCI-H838 cells[5].
    PACAP (1-38), human, ovine, rat (300 nM; 4 h) stimulates generation of APPsα in neural cells[6].
    PACAP (1-38), human, ovine, rat (0.01-10 nM; HEK 293 cells) stimulates neural cells express endogenous PAC1 receptors by cAMP accumulation and by an increase in cytosolic free calcium and induces elevation of the intracellular Ca2+ concentration in a dose-dependent manner with an EC50 value of 0.81 nM[6].
    PACAP (1-38), human, ovine, rat (0.01 nM; 48 h) elicits potent and efficacious stimulation of NPY secretion from SCG neuronal cultures[7].
    PACAP (1-38), human, ovine, rat (100 nM; 14 d) produces sustained stimulated NPY and catecholamine secretionmpathetic neurons[7].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Cell Viability Assay[1]

    Cell Line: NCI-H838 cells
    Concentration: 10 nM
    Incubation Time: 48 hours
    Result: Increased the number of NCI-H838 cells by 72%.

    Western Blot Analysis[1]

    Cell Line: NCI-H838 cells
    Concentration: 100 nM
    Incubation Time: 2 minutes
    Result: Increased tyrosine phosphorylation of the EGFR, HER2, and ERK by 377, 299 and 216%, respectively.
    In Vivo

    PACAP (1-38), human, ovine, rat alone in sham animals does not result in changes in any of the retinal layers. PACAP (1-38), human, ovine, rat is dissolved in solutio ophthalmica cum benzalkonio leads to significant protection in the retina in bilateral common carotid artery occlusion (BCCAO)-lesioned retinas; retinas treated with PACAP (1-38) eye drops have preserved structure compared to control retinas[4].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Peso molecular

    4534.26

    Fòrmula

    C203H331N63O53S

    No. CAS
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

    Sequence Shortening

    HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

    Envío

    Room temperature in continental US; may vary elsewhere.

    Almacenamiento

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

    Solvente y solubilidad
    In Vitro: 

    H2O : 50 mg/mL (11.03 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2205 mL 1.1027 mL 2.2054 mL
    5 mM 0.0441 mL 0.2205 mL 0.4411 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Calculadora de molaridad

    • Calculadora de dilución

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Pureza y Documentación

    Purity: 99.99%

    Referencias

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2205 mL 1.1027 mL 2.2054 mL 5.5136 mL
    5 mM 0.0441 mL 0.2205 mL 0.4411 mL 1.1027 mL
    10 mM 0.0221 mL 0.1103 mL 0.2205 mL 0.5514 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    Nombre del producto

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    PACAP (1-38), human, ovine, rat
    Cat. No.:
    HY-P0221
    Cantidad:
    MCE Japan Authorized Agent: