2. GPCR/G Protein Stem Cell/Wnt MAPK/ERK Pathway JAK/STAT Signaling Protein Tyrosine Kinase/RTK Metabolic Enzyme/Protease Immunology/Inflammation NF-κB Neuronal Signaling Membrane Transporter/Ion Channel
  3. PACAP Receptor ERK EGFR Reactive Oxygen Species (ROS) Calcium Channel
  4. PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat  (Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 38)

Cat. No.: HY-P0221 Purity: 99.99%
COA
SDS
Handling Instructions Technical Support

PACAP (1-38), human, ovine, rat is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat increases the α-secretase activity. PACAP (1-38), human, ovine, rat elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat can be used for neurotrophic and neuroprotective research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 137061-48-4

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 5 publication(s) in Google Scholar

Other Forms of PACAP (1-38), human, ovine, rat:

PACAP (1-38), human, ovine, rat Related Antibodies

Top Publications Citing Use of Products

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49.  [Abstract]

    Latency to eat and food consumption in NSF at 30 min post-PACAP (1-38) (0.4, 2.0, 4.0 ng/site; administrated intrahippocampally in a volume of 0.2 μL) [F (3, 28) = 5.940, P = 0.0029; F (3, 28) = 14.16, P < 0.0001]. The results showed that 30 minutes after the administration of low and medium doses of PACAP (1-38), a shortened feeding latency and increased food intake were observed in the Novelty Suppressed Feeding (NSF) paradigm.

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49.  [Abstract]

    Immobility time in FST at 7 d post-PACAP (1-38) [F (3, 28) = 3.415, P = 0.0309] (n = 8). One-way ANOVA, *P < 0.05, **P < 0.01, ***P < 0.001. The immediate and lasting antidepressant activity with the infusion of 0.4 ng/site of hippocampal PACAP (1-38) (administrated intrahippocampally in a volume of 0.2 μL) in mice subjected to chronic mild stress (CMS).

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2023 Aug 8;21(1):261.  [Abstract]

    Colocalization of CY5.5-PACAP (4 h), CY3-HA NGs in HA NGs@exosomes from primary neuronal cells by fluorescent microscopy. Scale bar: 50 μm. Immunofluorescence staining showed the co-localization of PACAP (1-38) (200 µg/mL; overnight) and HA nanogels, indicating the successful encapsulation of PACAP (1-38) into HA NGs@exosomes in primary neuronal cells.

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705.  [Abstract]

    SCs were treated with various concentrations of PACAP (1-38) (PACAP, 1-100 nM) for 48 h and then FGF17, CTSS and MMP‐12 expression was measured by western blotting. Western blotting showed that PACAP (1-38) (rPACAP) induced expression of FGF17, CTSS and MMP‐12 in SCs.

    PACAP (1-38), human, ovine, rat purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705.  [Abstract]

    Volcano plot of DEGs in SCs after PACAP (1-38) (100 nM; 48 h) treatment. Analysis of upregulated DEGs induced by PACAP (1-38) showed that fibroblast growth factor 17 (FGF17) expression was significantly upregulated in the treatment group (log2 fold‐change = 2.89, p = 0.0019).

    View All PACAP Receptor Isoform Specific Products:

    View All Isoforms
    PAC1 Receptor VPAC2 receptor

    View All ERK Isoform Specific Products:

    View All Isoforms
    ERK ERK1 ERK2 ERK5 ERK8

    View All EGFR Isoform Specific Products:

    View All Isoforms
    EGFR/ErbB1/HER1 ErbB2/HER2 ErbB3/HER3 ErbB4/HER4

    View All Calcium Channel Isoform Specific Products:

    View All Isoforms
    N-type calcium channel L-type calcium channel P/Q-type calcium channel T-type calcium channel Calcium Channel

    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    PACAP (1-38), human, ovine, rat is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat increases the α-secretase activity. PACAP (1-38), human, ovine, rat elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat can be used for neurotrophic and neuroprotective research[1][2][3][4][5][6][7].

    IC50 & Target

    IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP1), and 1 nM (PACAP type II receptor VIP2)[1]
    In Vitro

    PACAP (1-38), human, ovine, rat is a fragment of pituitary adenylate cyclase activating polypeptide[1].
    PACAP (1-38), human, ovine, rat shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2].
    In vitro, PACAP (1-38), human, ovine, rat relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].
    PACAP (1-38), human, ovine, rat (100 nM; 2 min; NCI-H838 cells) induces EGFR, HER2 and ERK tyrosine phosphorylation[5].
    PACAP (1-38), human, ovine, rat (100 nM; 30 min; NCI-H838 cells) induces EGFR tyrosine phosphorylation with generates ROS and increases ROS levels by 51%[5].
    PACAP (1-38), human, ovine, rat (10 nM; 48 h) stimulates the growth of NCI-H838 cells[5].
    PACAP (1-38), human, ovine, rat (300 nM; 4 h) stimulates generation of APPsα in neural cells[6].
    PACAP (1-38), human, ovine, rat (0.01-10 nM; HEK 293 cells) stimulates neural cells express endogenous PAC1 receptors by cAMP accumulation and by an increase in cytosolic free calcium and induces elevation of the intracellular Ca2+ concentration in a dose-dependent manner with an EC50 value of 0.81 nM[6].
    PACAP (1-38), human, ovine, rat (0.01 nM; 48 h) elicits potent and efficacious stimulation of NPY secretion from SCG neuronal cultures[7].
    PACAP (1-38), human, ovine, rat (100 nM; 14 d) produces sustained stimulated NPY and catecholamine secretionmpathetic neurons[7].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    PACAP (1-38), human, ovine, rat Related Antibodies

    Cell Viability Assay[1]

    Cell Line: NCI-H838 cells
    Concentration: 10 nM
    Incubation Time: 48 hours
    Result: Increased the number of NCI-H838 cells by 72%.

    Western Blot Analysis[1]

    Cell Line: NCI-H838 cells
    Concentration: 100 nM
    Incubation Time: 2 minutes
    Result: Increased tyrosine phosphorylation of the EGFR, HER2, and ERK by 377, 299 and 216%, respectively.
    In Vivo

    PACAP (1-38), human, ovine, rat alone in sham animals does not result in changes in any of the retinal layers. PACAP (1-38), human, ovine, rat is dissolved in solutio ophthalmica cum benzalkonio leads to significant protection in the retina in bilateral common carotid artery occlusion (BCCAO)-lesioned retinas; retinas treated with PACAP (1-38) eye drops have preserved structure compared to control retinas[4].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
    Molecular Weight

    4534.26

    Formula

    C203H331N63O53S
    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
    Sequence Shortening

    HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
    Shipping

    Room temperature in continental US; may vary elsewhere.
    Storage

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

    Solvent & Solubility
    In Vitro: 

    H2O : 50 mg/mL (11.03 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2205 mL 1.1027 mL 2.2054 mL
    5 mM 0.0441 mL 0.2205 mL 0.4411 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation

    Purity: 99.99%

    SDS (252 KB)

    COA (264 KB) RP-HPLC (283 KB) MS (70 KB)

    Handling Instructions (2659 KB)
    References

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2205 mL 1.1027 mL 2.2054 mL 5.5136 mL
    5 mM 0.0441 mL 0.2205 mL 0.4411 mL 1.1027 mL
    10 mM 0.0221 mL 0.1103 mL 0.2205 mL 0.5514 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    PACAP (1-38), human, ovine, rat Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Keywords:

    PACAP (1-38), human, ovine, rat137061-48-4Pituitary Adenylate Cyclase Activating Polypeptide 38Pituitary Adenylate Cyclase Activating Polypeptide38Pituitary Adenylate Cyclase Activating Polypeptide-38PACAP ReceptorERKEGFRReactive Oxygen Species (ROS)Calcium ChannelPituitary adenylyl cyclase activating polypeptide receptorExtracellular signal regulated kinasesEpidermal growth factor receptorErbB-1HER1Ca2+ channelsCa channelsPAC1cAMPCa2+HER2 ERKROS NPYcatecholamineInhibitorinhibitorinhibit

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Requested Quantity *

    Applicant Name *

    		 

    Salutation

    Email Address *

    		 

    Phone Number *

    Department

    		 

    Organization Name *

    City

    State

    Country or Region *

    		      

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    PACAP (1-38), human, ovine, rat
    Cat. No.:
    HY-P0221
    Quantity:
    MCE Japan Authorized Agent:

    Customer Review

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Lot #

    Applicant Name *

    		 

    Email Address *

    Phone Number

    		 

    Department *

    Organization Name *

    		 

    Country or Region *

    Remarks

    SAFETY DATA SHEET (SDS)

    English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.