PACAP (1-38) free acid
Based on 1 Customer Validation
PACAP (1-38) free acid is a desamido-PACAP (1-38), human, ovine, rat (HY-P0221). PACAP (1-38) free acid can activate the human PAC1 receptor. PACAP (1-38) free acid induces cyclic AMP (cAMP) generation in both NS-1 neuroendocrine cells and non-neuroendocrine HEK293 cells.
For research use only. We do not sell to patients.
- Purity: 99.94%
- CAS No.: 129405-61-4
- Formula: C203H330N62O54S
- Molecular Weight:4535.24
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
All PACAP Receptor Isoforms
More
Biological Activity
Description
In Vitro
PACAP (1-38) free acid (desamido-PACAP38; 48 h) promotes neuroendocrine cell differentiation in NS-1 cells, with an EC50 of 10.6 nM[1].
PACAP (1-38) free acid (0.1-300 nM; 24 h) induces cell growth arrest in NS-1 cells.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 129405-61-4
-
Appearance Solid
-
Molecular Weight 4535.24
-
Formula C203H330N62O54S
-
Color White to off-white
-
Sequence
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys
-
Sequence Shortening
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (22.05 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 100 mg/mL (22.05 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.2205 mL | 1.1025 mL | 2.2050 mL | 5.5124 mL |
| 5 mM | 0.0441 mL | 0.2205 mL | 0.4410 mL | 1.1025 mL | |
| 10 mM | 0.0220 mL | 0.1102 mL | 0.2205 mL | 0.5512 mL | |
| 15 mM | 0.0147 mL | 0.0735 mL | 0.1470 mL | 0.3675 mL | |
| 20 mM | 0.0110 mL | 0.0551 mL | 0.1102 mL | 0.2756 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.