1. GPCR/G Protein
  2. PACAP Receptor
  3. PACAP (1-38) free acid

PACAP (1-38) free acid is a desamido-PACAP (1-38), human, ovine, rat (HY-P0221). PACAP (1-38) free acid can activate the human PAC1 receptor. PACAP (1-38) free acid induces cyclic AMP (cAMP) generation in both NS-1 neuroendocrine cells and non-neuroendocrine HEK293 cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (1-38) free acid

PACAP (1-38) free acid Chemical Structure

CAS No. : 129405-61-4

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of PACAP (1-38) free acid:

Top Publications Citing Use of Products

View All PACAP Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

PACAP (1-38) free acid is a desamido-PACAP (1-38), human, ovine, rat (HY-P0221). PACAP (1-38) free acid can activate the human PAC1 receptor. PACAP (1-38) free acid induces cyclic AMP (cAMP) generation in both NS-1 neuroendocrine cells and non-neuroendocrine HEK293 cells[1].

In Vitro

PACAP (1-38) free acid (desamido-PACAP38; 48 h) promotes neuroendocrine cell differentiation in NS-1 cells, with an EC50 of 10.6 nM[1].
PACAP (1-38) free acid (0.1-300 nM; 24 h) induces cell growth arrest in NS-1 cells.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4535.24

Formula

C203H330N62O54S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (22.05 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : ≥ 100 mg/mL (22.05 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2205 mL 1.1025 mL 2.2050 mL
5 mM 0.0441 mL 0.2205 mL 0.4410 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.94%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.2205 mL 1.1025 mL 2.2050 mL 5.5124 mL
5 mM 0.0441 mL 0.2205 mL 0.4410 mL 1.1025 mL
10 mM 0.0220 mL 0.1102 mL 0.2205 mL 0.5512 mL
15 mM 0.0147 mL 0.0735 mL 0.1470 mL 0.3675 mL
20 mM 0.0110 mL 0.0551 mL 0.1102 mL 0.2756 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PACAP (1-38) free acid
Cat. No.:
HY-P0221C
Quantity:
MCE Japan Authorized Agent: