PACAP (1-38) free acid TFA

Cat. No.: HY-P0221B: Ficha de datos Instrucciones de manejo
FAQs
Technical Support

PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1.

Para uso exclusivo en investigación. No vendemos a pacientes.

PACAP (1-38) free acid TFA Estructura química

Tamaño		Stock
MOQ		Minimum order quantity
50 mg		Obtener un presupuesto
100 mg		Obtener un presupuesto
250 mg		Obtener un presupuesto
Other size		Obtener un presupuesto

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of PACAP (1-38) free acid TFA:

PACAP (1-38) free acid

Other Forms of PACAP (1-38) free acid TFA:

PACAP (1-38), human, ovine, rat In-stock
PACAP (1-38) free acid In-stock

Recomendaciones destacadas

•Related Small Molecules:

•Related Proteins:

Ver todos los productos específicos de isoformas PACAP Receptor:

Ver todas las isoformas

PAC1 Receptor VPAC2 receptor

Actividad biológica
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn

In Vitro

PACAP (1-38) free acid TFA (1 nM) increases substance P, gastrin releasing peptide and vasoactive intestinal polypeptide release^[1].
PACAP (1-38) free acid TFA (100 nM; 10 min) induces tyrosine phosphorylation of NR2B in rat hippocampal slices^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis^[2]

Cell Line:	Rat hippocampal slices
Concentration:	100 nM
Incubation Time:	10 min
Result:	Caused an enhancement of tyrosine phosphorylation of NR2B.

Peso molecular

4649.26

Fòrmula

C₂₀₅H₃₃₁F₃N₆₂O₅₆S

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Instrucciones de manejo (2659 KB)

Referencias

[1]. Tornøe K, et al. PACAP 1-38 as neurotransmitter in the porcine antrum. Regul Pept. 2001 Sep 15;101(1-3):109-21. [Content Brief]

[2]. Yaka R, et al. Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J Biol Chem. 2003 Mar 14;278(11):9630-8. [Content Brief]