PACAP (1-38) free acid TFA
PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1.
For research use only. We do not sell to patients.
- Formula: C205H331F3N62O56S
- Molecular Weight:4649.26
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
All PACAP Receptor Isoforms
More
Biological Activity
Description
In Vitro
PACAP (1-38) free acid TFA (1 nM) increases substance P, gastrin releasing peptide and vasoactive intestinal polypeptide release[1].
PACAP (1-38) free acid TFA (100 nM; 10 min) induces tyrosine phosphorylation of NR2B in rat hippocampal slices[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Rat hippocampal slices
-
Concentration:100 nM
-
Incubation Time:10 min
-
Result:Caused an enhancement of tyrosine phosphorylation of NR2B.
Chemical Information
-
Molecular Weight 4649.26
-
Formula C205H331F3N62O56S
-
Sequence
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys
-
Sequence Shortening
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Tornøe K, et al. PACAP 1-38 as neurotransmitter in the porcine antrum. Regul Pept. 2001 Sep 15;101(1-3):109-21. [Content Brief]
[2]. Yaka R, et al. Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J Biol Chem. 2003 Mar 14;278(11):9630-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)