PACAP (1-38), human, ovine, rat TFA
Based on 5 publication(s) in Google Scholar
PACAP (1-38), human, ovine, rat TFA is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat TFA binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat TFA increases the α-secretase activity. PACAP (1-38), human, ovine, rat TFA elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat TFA demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat TFA can be used for neurotrophic and neuroprotective research.
For research use only. We do not sell to patients.
- Formula: C203H331N63O53S.C2HF3O2
- Molecular Weight:4534.26 (free base)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) PACAP (1-38), human, ovine, rat TFA
More-
In Vivo Efficacy Study
-
In Vivo Efficacy Study
-
IF
-
WB
-
Bio/Physico-chemical Assay
All PACAP Receptor Isoforms
MoreAll EGFR Isoforms
MoreAll Calcium Channel Isoforms
More
Biological Activity
Description
IC50 & Target
IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP1), and 1 nM (PACAP type II receptor VIP2)[1]
In Vitro
PACAP (1-38), human, ovine, rat TFA is a fragment of pituitary adenylate cyclase activating polypeptide[1].
PACAP (1-38), human, ovine, rat TFA shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2].
In vitro, PACAP (1-38), human, ovine, rat TFA relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].
PACAP (1-38), human, ovine, rat TFA (100 nM; 2 min; NCI-H838 cells) induces EGFR, HER2 and ERK tyrosine phosphorylation[5].
PACAP (1-38), human, ovine, rat TFA (100 nM; 30 min; NCI-H838 cells) induces EGFR tyrosine phosphorylation with generates ROS and increases ROS levels by 51%[5].
PACAP (1-38), human, ovine, rat TFA (10 nM; 48 h) stimulates the growth of NCI-H838 cells[5].
PACAP (1-38), human, ovine, rat TFA (300 nM; 4 h) stimulates generation of APPsα in neural cells[6].
PACAP (1-38), human, ovine, rat TFA (0.01-10 nM; HEK 293 cells) stimulates neural cells express endogenous PAC1 receptors by cAMP accumulation and by an increase in cytosolic free calcium and induces elevation of the intracellular Ca2+ concentration in a dose-dependent manner with an EC50 value of 0.81 nM[6].
PACAP (1-38), human, ovine, rat TFA (0.01 nM; 48 h) elicits potent and efficacious stimulation of NPY secretion from SCG neuronal cultures[7].
PACAP (1-38), human, ovine, rat TFA (100 nM; 14 d) produces sustained stimulated NPY and catecholamine secretionmpathetic neurons[7].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:NCI-H838 cells
-
Concentration:10 nM
-
Incubation Time:48 hours
-
Result:Increased the number of NCI-H838 cells by 72%.
-
Cell Line:NCI-H838 cells
-
Concentration:100 nM
-
Incubation Time:2 minutes
-
Result:Increased tyrosine phosphorylation of the EGFR, HER2, and ERK by 377, 299 and 216%, respectively.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 4534.26 (free base)
-
Formula C203H331N63O53S.C2HF3O2
-
Synonyms
Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA
-
Sequence
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
-
Sequence Shortening
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (5)
-
Journal Impact Factor
-
Most Recent
-
Mil Med Res
2024 Jul 23;11(1):49. PMID: 39044298
PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49. [Abstract]
Latency to eat and food consumption in NSF at 30 min post-PACAP (1-38) (0.4, 2.0, 4.0 ng/site; administrated intrahippocampally in a volume of 0.2 μL) [F (3, 28) = 5.940, P = 0.0029; F (3, 28) = 14.16, P < 0.0001]. The results showed that 30 minutes after the administration of low and medium doses of PACAP (1-38), a shortened feeding latency and increased food intake were observed in the Novelty Suppressed Feeding (NSF) paradigm.
PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49. [Abstract]
Immobility time in FST at 7 d post-PACAP (1-38) [F (3, 28) = 3.415, P = 0.0309] (n = 8). One-way ANOVA, *P < 0.05, **P < 0.01, ***P < 0.001. The immediate and lasting antidepressant activity with the infusion of 0.4 ng/site of hippocampal PACAP (1-38) (administrated intrahippocampally in a volume of 0.2 μL) in mice subjected to chronic mild stress (CMS).
-
J Nanobiotechnology
Exosome-sheathed ROS-responsive nanogel to improve targeted therapy in perimenopausal depression. [Abstract]2023 Aug 8;21(1):261. PMID: 37553718
PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2023 Aug 8;21(1):261. [Abstract]
Colocalization of CY5.5-PACAP (4 h), CY3-HA NGs in HA NGs@exosomes from primary neuronal cells by fluorescent microscopy. Scale bar: 50 μm. Immunofluorescence staining showed the co-localization of PACAP (1-38) (200 µg/mL; overnight) and HA nanogels, indicating the successful encapsulation of PACAP (1-38) into HA NGs@exosomes in primary neuronal cells.
-
J Cell Mol Med
Dedifferentiated Schwann cells promote perineural invasion mediated by the PACAP paracrine signalling in cervical cancer. [Abstract]2023 Dec;27(23):3692-3705. PMID: 37830980
PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705. [Abstract]
SCs were treated with various concentrations of PACAP (1-38) (PACAP, 1-100 nM) for 48 h and then FGF17, CTSS and MMP‐12 expression was measured by western blotting. Western blotting showed that PACAP (1-38) (rPACAP) induced expression of FGF17, CTSS and MMP‐12 in SCs.
PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705. [Abstract]
Volcano plot of DEGs in SCs after PACAP (1-38) (100 nM; 48 h) treatment. Analysis of upregulated DEGs induced by PACAP (1-38) showed that fibroblast growth factor 17 (FGF17) expression was significantly upregulated in the treatment group (log2 fold‐change = 2.89, p = 0.0019).
-
-
Solvent & Solubility
In Vitro
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
|---|---|---|
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
|---|---|
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Purity & Documentation
References
[1]. Gourlet P, et al. Fragments of pituitary adenylate cyclase activating polypeptide discriminate between type I and II recombinant receptors. Eur J Pharmacol. 1995 Dec 4;287(1):7-11. [Content Brief]
[2]. Yamaguchi N. Pituitary adenylate cyclase activating polypeptide enhances glucose-evoked insulin secretion in the canine pancreas in vivo. JOP. 2001 Sep;2(5):306-16. [Content Brief]
[3]. Lindén A, et al. Inhibition of bronchoconstriction by pituitary adenylate cyclase activating polypeptide (PACAP 1-27) in guinea-pigs in vivo. Br J Pharmacol. 1995 Jul;115(6):913-6. [Content Brief]
[4]. Werling D, et al. Passage through the Ocular Barriers and Beneficial Effects in Retinal Ischemia of Topical Application of PACAP (1-38) in Rodents. Int J Mol Sci. 2017 Mar 21;18(3). pii: E675. [Content Brief]
[5]. Moody TW, et, al. PAC1 regulates receptor tyrosine kinase transactivation in a reactive oxygen species-dependent manner. Peptides. 2019 Oct;120:170017. [Content Brief]
[6]. Kojro E, et, al. The neuropeptide PACAP promotes the alpha-secretase pathway for processing the Alzheimer amyloid precursor protein. FASEB J. 2006 Mar;20(3):512-4. [Content Brief]
[7]. Braas KM, et, al. Pituitary adenylate cyclase-activating polypeptides, PACAP-38 and PACAP-27, regulation of sympathetic neuron catecholamine, and neuropeptide Y expression through activation of type I PACAP/VIP receptor isoforms. Ann N Y Acad Sci. 1996 Dec 26;805:204-16; discussion 217-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Keywords
- PACAP (1-38), human, ovine, rat
- Pituitary Adenylate Cyclase Activating Polypeptide 38
- Pituitary Adenylate Cyclase Activating Polypeptide38
- Pituitary Adenylate Cyclase Activating Polypeptide-38
- PACAP Receptor
- ERK
- EGFR
- Reactive Oxygen Species (ROS)
- Calcium Channel
- PAC1
- cAMP
- Ca2+
- HER2
- ERK
- ROS
- NPY
- catecholamine
- Inhibitor
- inhibitor
- inhibit