Cat. No.: HY-P0221A

Copy Link Print Information

PACAP (1-38), human, ovine, rat TFA

Name: PACAP (1-38), human, ovine, rat TFA
Brand: MedChemExpress
SKU: HY-P0221A
Availability: PreOrder

(Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA)

5 Cited Publications

Customer Review

Based on 5 publication(s) in Google Scholar

PACAP (1-38), human, ovine, rat TFA is a PAC₁ receptor agonist. PACAP (1-38), human, ovine, rat TFA binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC₅₀s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat TFA increases the α-secretase activity. PACAP (1-38), human, ovine, rat TFA elevates cytosolic Ca²⁺, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat TFA demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat TFA can be used for neurotrophic and neuroprotective research.

For research use only. We do not sell to patients.

Formula: C₂₀₃H₃₃₁N₆₃O₅₃S.C₂HF₃O₂
Molecular Weight:4534.26 (free base)

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

PACAP (1-38), human, ovine, rat TFA Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Antibody-Drug Conjugates

One-stop solution for XDC (ADC/PDC/RDC/ApDC/FDC/ISAC/VDC/SMDC)

Biological Activity
- Description
- IC₅₀ & Target
- In Vitro
- In Vivo
Chemical Information
Publications (5)
Solvent & Solubility
- In Vitro
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

IC₅₀ & Target

IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP₁), and 1 nM (PACAP type II receptor VIP₂)^[1]

All PACAP Receptor Isoforms :

All ERK Isoforms :

All EGFR Isoforms :

All Calcium Channel Isoforms :

In Vitro

PACAP (1-38), human, ovine, rat TFA is a fragment of pituitary adenylate cyclase activating polypeptide^[1].
PACAP (1-38), human, ovine, rat TFA shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas^[2].
In vitro, PACAP (1-38), human, ovine, rat TFA relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)^[3].
PACAP (1-38), human, ovine, rat TFA (100 nM; 2 min; NCI-H838 cells) induces EGFR, HER2 and ERK tyrosine phosphorylation^[5].
PACAP (1-38), human, ovine, rat TFA (100 nM; 30 min; NCI-H838 cells) induces EGFR tyrosine phosphorylation with generates ROS and increases ROS levels by 51%^[5].
PACAP (1-38), human, ovine, rat TFA (10 nM; 48 h) stimulates the growth of NCI-H838 cells^[5].
PACAP (1-38), human, ovine, rat TFA (300 nM; 4 h) stimulates generation of APPsα in neural cells^[6].
PACAP (1-38), human, ovine, rat TFA (0.01-10 nM; HEK 293 cells) stimulates neural cells express endogenous PAC1 receptors by cAMP accumulation and by an increase in cytosolic free calcium and induces elevation of the intracellular Ca²⁺ concentration in a dose-dependent manner with an EC₅₀ value of 0.81 nM^[6].
PACAP (1-38), human, ovine, rat TFA (0.01 nM; 48 h) elicits potent and efficacious stimulation of NPY secretion from SCG neuronal cultures^[7].
PACAP (1-38), human, ovine, rat TFA (100 nM; 14 d) produces sustained stimulated NPY and catecholamine secretionmpathetic neurons^[7].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay^[1]

Cell Line:

NCI-H838 cells
Concentration:

10 nM
Incubation Time:

48 hours
Result:

Increased the number of NCI-H838 cells by 72%.

Western Blot Analysis^[1]

Cell Line:

NCI-H838 cells
Concentration:

100 nM
Incubation Time:

2 minutes
Result:

Increased tyrosine phosphorylation of the EGFR, HER2, and ERK by 377, 299 and 216%, respectively.

In Vivo

PACAP (1-38), human, ovine, rat TFA alone in sham animals does not result in changes in any of the retinal layers. PACAP (1-38), human, ovine, rat TFA is dissolved in solutio ophthalmica cum benzalkonio leads to significant protection in the retina in bilateral common carotid artery occlusion (BCCAO)-lesioned retinas; retinas treated with PACAP (1-38) eye drops have preserved structure compared to control retinas^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

Molecular Weight 4534.26 (free base)
Formula C₂₀₃H₃₃₁N₆₃O₅₃S.C₂HF₃O₂
Synonyms

Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA
Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Publications (5)

All In Vivo Efficacy StudyIFWBBio/Physico-chemical Assay

Sort by:

Journal Impact Factor

Mil Med Res

Hippocampal PACAP signaling activation triggers a rapid antidepressant response. [Abstract]

2024 Jul 23;11(1):49. PMID: 39044298

PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49. [Abstract]

Latency to eat and food consumption in NSF at 30 min post-PACAP (1-38) (0.4, 2.0, 4.0 ng/site; administrated intrahippocampally in a volume of 0.2 μL) [F (3, 28) = 5.940, P = 0.0029; F (3, 28) = 14.16, P < 0.0001]. The results showed that 30 minutes after the administration of low and medium doses of PACAP (1-38), a shortened feeding latency and increased food intake were observed in the Novelty Suppressed Feeding (NSF) paradigm.

PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2024 Jul 23;11(1):49. [Abstract]

Immobility time in FST at 7 d post-PACAP (1-38) [F (3, 28) = 3.415, P = 0.0309] (n = 8). One-way ANOVA, *P < 0.05, **P < 0.01, ***P < 0.001. The immediate and lasting antidepressant activity with the infusion of 0.4 ng/site of hippocampal PACAP (1-38) (administrated intrahippocampally in a volume of 0.2 μL) in mice subjected to chronic mild stress (CMS).
J Nanobiotechnology

Exosome-sheathed ROS-responsive nanogel to improve targeted therapy in perimenopausal depression. [Abstract]

2023 Aug 8;21(1):261. PMID: 37553718

PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2023 Aug 8;21(1):261. [Abstract]

Colocalization of CY5.5-PACAP (4 h), CY3-HA NGs in HA NGs@exosomes from primary neuronal cells by fluorescent microscopy. Scale bar: 50 μm. Immunofluorescence staining showed the co-localization of PACAP (1-38) (200 µg/mL; overnight) and HA nanogels, indicating the successful encapsulation of PACAP (1-38) into HA NGs@exosomes in primary neuronal cells.
J Cell Mol Med

Dedifferentiated Schwann cells promote perineural invasion mediated by the PACAP paracrine signalling in cervical cancer. [Abstract]

2023 Dec;27(23):3692-3705. PMID: 37830980

PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705. [Abstract]

SCs were treated with various concentrations of PACAP (1-38) (PACAP, 1-100 nM) for 48 h and then FGF17, CTSS and MMP‐12 expression was measured by western blotting. Western blotting showed that PACAP (1-38) (rPACAP) induced expression of FGF17, CTSS and MMP‐12 in SCs.

PACAP (1-38), human, ovine, rat TFA purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2023 Dec;27(23):3692-3705. [Abstract]

Volcano plot of DEGs in SCs after PACAP (1-38) (100 nM; 48 h) treatment. Analysis of upregulated DEGs induced by PACAP (1-38) showed that fibroblast growth factor 17 (FGF17) expression was significantly upregulated in the treatment group (log2 fold‐change = 2.89, p = 0.0019).
bioRxiv

2025 February 27.
Research Square Preprint

2023 Apr 19.

Solvent & Solubility

In Vitro

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (295 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Gourlet P, et al. Fragments of pituitary adenylate cyclase activating polypeptide discriminate between type I and II recombinant receptors. Eur J Pharmacol. 1995 Dec 4;287(1):7-11. [Content Brief]

[2]. Yamaguchi N. Pituitary adenylate cyclase activating polypeptide enhances glucose-evoked insulin secretion in the canine pancreas in vivo. JOP. 2001 Sep;2(5):306-16. [Content Brief]

[3]. Lindén A, et al. Inhibition of bronchoconstriction by pituitary adenylate cyclase activating polypeptide (PACAP 1-27) in guinea-pigs in vivo. Br J Pharmacol. 1995 Jul;115(6):913-6. [Content Brief]

[4]. Werling D, et al. Passage through the Ocular Barriers and Beneficial Effects in Retinal Ischemia of Topical Application of PACAP (1-38) in Rodents. Int J Mol Sci. 2017 Mar 21;18(3). pii: E675. [Content Brief]

[5]. Moody TW, et, al. PAC1 regulates receptor tyrosine kinase transactivation in a reactive oxygen species-dependent manner. Peptides. 2019 Oct;120:170017. [Content Brief]

[6]. Kojro E, et, al. The neuropeptide PACAP promotes the alpha-secretase pathway for processing the Alzheimer amyloid precursor protein. FASEB J. 2006 Mar;20(3):512-4. [Content Brief]

[7]. Braas KM, et, al. Pituitary adenylate cyclase-activating polypeptides, PACAP-38 and PACAP-27, regulation of sympathetic neuron catecholamine, and neuropeptide Y expression through activation of type I PACAP/VIP receptor isoforms. Ann N Y Acad Sci. 1996 Dec 26;805:204-16; discussion 217-8. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

PACAP (1-38), human, ovine, rat TFA

5 Cited Publications

100 mg Get Quote

Subscribe to the

MedChemExpress

Newsletter

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Product Name:
CAS No.:
Species:
Purity:
Quantity:

PACAP (1-38), human, ovine, rat TFA

Publications Citing Use of MedChemExpress (MCE) PACAP (1-38), human, ovine, rat TFA

All PACAP Receptor Isoforms

All ERK Isoforms

All EGFR Isoforms

All Calcium Channel Isoforms

Biological Activity

Chemical Information

Publications (5)

Solvent & Solubility

Purity & Documentation

References

Calculators

Help & FAQs

PACAP (1-38), human, ovine, rat TFA Related Classifications

HY-P0221A Related Classifications

Bioz