GCGR

Glucagon Receptor

GCGR

Related Products

GCGR (glucagon receptor) is in the G protein-coupled receptor family, that is important in controlling blood glucose levels. The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to G alpha i, Gs and to a lesser extent G alpha q. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP. In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney with lesser amounts found in heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.

GCGR Produits associés (190)
Protéines recombinantes (14)
Antibodies (3)

By Effects:	Inhibitors (12) Agonists (90) Controls (4) Antagonists (40) Activator (1) Modulators (8)

Cat. No.	Nom du produit	Effet	Pureté	Chemical Structure

HY-116854

NNC 92-1687	Antagonist	98.74%
NNC 92-1687 is a non-peptide competitive human glucagon receptor antagonist (IC₅₀=20 μM; K_i=9.1 μM). NNC 92-1687 can be used in the research of type 2 diabetes.

HY-P10032A

NN1177 TFA	Agonist	99.22%
NN1177 (NNC9204-1177) TFA is a long-acting GLP-1/glucagon receptor co-agonist. NN1177 TFA can induce a dose-dependent body weight loss in diet-induced obese (DIO) mice.

HY-145632A

Pemvidutide TFA	Antagonist	98.07%
Pemvidutide (ALT-801) TFA is a GLP-1R/GCGR dual agonist, shows striking reductions in body weight, liver fat and serum lipids. Pemvidutide TFA can be used in non-alcoholic steatohepatitis (NASH) and obesity research.

HY-13443B

Exendin-4-Lys-azide TFA	Agonist	99.84%
Exendin-4-Lys-azide TFA (Compound Ex40) is an azide derivative of Exendin-4-Lys-azide, Exendin-4, which can be used for coupling/click chemistry.

HY-P1145

Glucagon-like peptide 1 (1-37), human	Agonist	99.70%
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.

HY-P3622

(Ser8)-GLP-1 (7-36) amide, human	Agonist	99.10%
(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.

HY-P5815A

GLP-1 (1-36) amide (human, rat) TFA		98.02%
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) TFA is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) TFA can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells.

HY-141839

GLP-1R modulator C16	Modulator	98.67%
GLP-1R modulator C16 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC₅₀ 8.43 ± 3.82 μM).

HY-153476A

GIP/GLP-1 dual receptor agonist-1 sodium	Agonist	98.33%
GIP/GLP-1 dual receptor agonist-1 sodium is a GIP/GLP-1 dual receptor agonist. GIP/GLP-1 dual receptor agonist-1 sodium is used in the research of metabolic disorders and fatty liver diseases, including non-alcoholic steatohepatitis (NASH) and non-alcoholic fatty liver disease (NAFLD).

HY-P3491

Pegloxenatide	Agonist
Pegloxenatide (Polyethylene glycol loxenatide) is a long-acting glucagon-like peptide-1 receptor (GLP-1RA) agonist. Pegloxenatide has various activities such as lowering blood glucose, lowering blood lipids, improving body weight, anti-inflammation, promoting wound healing, protecting the liver, and protecting the heart. Pegloxenatide can be used in the research of type 2 diabetes and its multiple complications.

HY-124803

GPCR modulator-1	Modulator
GPCR modulator-1 is a negative allosteric modulator of the GLP-1 receptor (GLP-1R). GPCR modulator-1 can be used for the study of type 2 diabetes.

HY-P1228

HAEGTFT		98.81%
HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.

HY-P991099

Anti-GLP1R Antibody	Inhibitor
Anti-GLP1R Antibody is a human antibody expressed in CHO cells, targeting GLP1R. Anti-GLP1R Antibody can be referenced as Human IgG1 kappa, Isotype Control (HY-P99001).

HY-P3498

Elsiglutide	Agonist	99.64%
Elsiglutide (ZP1846) is a GLP-2 analogue, an orally active and selective GLP-2 receptor agonist, increases cell proliferation and reduces apoptosis in the intestine. Elsiglutide improves Lapatinib (HY-50898)-induced diarrhoea in rat model.

HY-P2497

Exendin (5-39)	Antagonist	99.43%
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.

HY-P1231

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS		99.03%
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

HY-P1226

HAEGTFTSD	Agonist	98.48%
HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner

HY-116819A

VU0453379 hydrochloride	Modulator	99.0%
VU0453379 hydrochloride is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC₅₀ of 1.3 μM.

HY-P1143

[Des-His1,Glu9]-Glucagon amide	Antagonist	99.32%
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA₂ of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes.

HY-P5074

GRPP (human)	Agonist	98.94%
GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets.

Nom
Email *

	Sorry, but the email address you supplied was invalid.

GCGR

GCGR

GCGR Produits associés (190)

Protéines recombinantes (14)

Antibodies (3)

GCGR Produits associés (190):