Exendin-4-Lys-azide TFA
Based on 1 Customer Validation
Exendin-4-Lys-azide TFA (Compound Ex40) is an azide derivative of Exendin-4-Lys-azide, Exendin-4, which can be used for coupling/click chemistry.
For research use only. We do not sell to patients.
- Purity: 99.84%
- Formula: C190H292N54O61S.xC2HF3O2
- Molecular Weight:4340.74 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Chemical Information
-
Appearance Solid
-
Molecular Weight 4340.74 (free base)
-
Formula C190H292N54O61S.xC2HF3O2
-
Color White to off-white
-
Sequence
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-{Lys(N3)}-NH2
-
Sequence Shortening
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-{Lys(N3)}-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (285 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)