Exendin-4
Based on 72 publication(s) in Google Scholar
Exendin‑4 (Exenatide) is an orally active, blood-brain barrier-permeable glucagon-like peptide-1 receptor (GLP‑1 receptor) agonist that resists degradation mediated by dipeptidyl peptidase IV. Exendin‑4 mediates multiple glucose-regulating effects, including stimulation of glucose-dependent insulin secretion, inhibition of glucagon production, increase in β-cell mass, delay of gastric emptying, reduction of food intake, improvement of peripheral insulin sensitivity, and restoration of normal islet structure. Exendin‑4 inhibits oxidative stress, alleviates inflammatory responses, and reduces neuronal apoptosis. Exendin‑4 reduces the aggregation level of mutant huntingtin, improves motor function, prolongs survival time, and regulates the expression levels of leptin and ghrelin. Exendin‑4 can be used in research related to type 2 diabetes, acute ischemic stroke, and Huntington's disease.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit : 99.89%
- CAS. Nr.: 141758-74-9
- Formel: C184H282N50O60S
- Molecular Weight:4186.57
-
Speicherung:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 2 years; -20°C, 1 year (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Exendin-4
More- Nature. 2025 May;641(8061):192-201. [Abstract]
- Cell Metab. 2026 Jan 6;38(1):50-64.e12. [Abstract]
- Cell Metab. 2025 Dec 2;37(12):2362-2380.e8. [Abstract]
- Gut. 2023 Feb;72(2):314-324. [Abstract]
- Bioact Mater. 2025 Nov 25:57:646-659. [Abstract]
- J Adv Res. 2025 Mar 10:S2090-1232(25)00174-2. [Abstract]
- Acta Pharm Sin B. 2026 Jun 1.
- Biomaterials. 2021 Aug:275:120944. [Abstract]
- Asian J Pharm Sci. 2024 Apr;19(2):100904. [Abstract]
- Int J Biol Sci. 2022 Jan 16;18(4):1328-1346. [Abstract]
- J Neuroinflammation. 2019 Nov 28;16(1):242. [Abstract]
- Int J Nanomedicine. 2025 Mar 17:20:3363-3378. [Abstract]
- Neural Regen Res. 2023 Aug;18(8):1818-1826. [Abstract]
- Mol Med. 2024 May 8;30(1):58. [Abstract]
- Drug Deliv. 2022 Dec;29(1):548-560. [Abstract]
- Br J Pharmacol. 2025 Jan;182(1):52-68. [Abstract]
- Br J Pharmacol. 2024 Oct;181(19):3556-3575. [Abstract]
- Br J Pharmacol. 2020 Aug;177(15):3389-3402. [Abstract]
- J Invest Dermatol. 2022 May;142(5):1349-1359.e8. [Abstract]
- Biochem Pharmacol. 2025 Oct 30;243(Pt 1):117483. [Abstract]
- Biochem Pharmacol. 2025 Sep 4;242(Pt 2):117306. [Abstract]
- Mol Metab. 2026 Jun 18:110:102403. [Abstract]
- Mol Metab. 2023 Dec:78:101811. [Abstract]
- J Mater Chem B. 2026 Apr 29;14(16):5051-5065. [Abstract]
- Inflamm Res. 2024 Jul;73(7):1185-1201. [Abstract]
- Biomacromolecules. 2024 Aug 12;25(8):4946-4955. [Abstract]
- Eur J Pharmacol. 2024 Dec 5:984:177029. [Abstract]
- Eur J Pharmacol. 2024 Dec 15:985:177106. [Abstract]
- Int J Mol Sci. 2026 Jun 26;27(13):5775.
- Int Immunopharmacol. 2024 Oct 25:140:112844. [Abstract]
- Int Immunopharmacol. 2023 Jul:120:110339. [Abstract]
- Int Immunopharmacol. 2021 Jan:90:107192. [Abstract]
- Am J Physiol Cell Physiol. 2024 Jul 1;327(1):C74-C96. [Abstract]
- Front Pharmacol. 2021 Jul 19;12:694476. [Abstract]
- BMC Biol. 2021 Mar 3;19(1):40. [Abstract]
- Front Pharmacol. 2019 Oct 25:10:1230. [Abstract]
- Chem Biol Interact. 2019 May 1:304:186-193. [Abstract]
- Sci Rep. 2024 Jun 14;14(1):13726. [Abstract]
- Sci Rep. 2017 Jun 28;7(1):4351. [Abstract]
- Structure. 2022 Apr 7;30(4):510-521.e3. [Abstract]
- Biomedicines. 2020 Nov 9;8(11):485. [Abstract]
- Acta Biochim Biophys Sin (Shanghai). 2017 Jul 1;49(7):573-580. [Abstract]
- Biochim Biophys Acta Mol Cell Res. 2022 May 27;1869(9):119300. [Abstract]
- Am J Physiol Endocrinol Metab. 2025 Mar 24. [Abstract]
- Am J Physiol Endocrinol Metab. 2020 Dec 1;319(6):E1019-E1030. [Abstract]
- J Biol Chem. 2018 Nov 23;293(47):18086-18098. [Abstract]
- J Chromatogr A. 2026 Jul 21:1786:467288.
- Mater Technol (N Y N Y). 2025 Jun 17.
- J Cell Physiol. 2021 May;236(5):3641-3659. [Abstract]
- ACS Med Chem Lett. 2026 May 4;17(5):963-972. [Abstract]
- J Funct Foods. 2023 Aug, 107, 105706.
- Exp Cell Res. 2023 Feb 15;423(2):113469. [Abstract]
- J Diabetes Res. 2019 Dec 9:2019:8905917. [Abstract]
- Front Behav Neurosci. 2022 Jan 5:15:769664. [Abstract]
- Neuroscience. 2026 Apr 16:600:112-129. [Abstract]
- Gerontology. 2023;69(5):603-614. [Abstract]
- Insects. 2024 Jul 5;15(7):503. [Abstract]
- Neurogastroenterol Motil. 2019 Feb;31(2):e13482. [Abstract]
- PLoS One. 2026 Mar 12;21(3):e0343995. [Abstract]
- J Mol Histol. 2025 Jun 28;56(4):210. [Abstract]
- Diabetol Int. 2025 Jun 5;16(3):568-579. [Abstract]
- bioRxiv. 2025 Nov 18:2025.05.09.653092. [Abstract]
- Seoul National University. 2025 Jan.
- medRxiv. 2024 Jul 23.
- Res Sq. 2024 Aug 11.
- bioRxiv. 2024 August 10.
- bioRxiv. 2024 May 8.
- bioRxiv. 2024 May 3:2024.05.01.591950. [Abstract]
- bioRxiv. 2024 Mar 20:2024.03.18.585583. [Abstract]
- Annals of the Romanian Society for Cell Biology. 2021 Mar 15.
- bioRxiv. 2020 Jul.
- SSRN. 2019 Jun 27.
-
PK/PD Analysis
-
In Vivo Imaging
-
RT-PCR
-
Cell Proliferation/Viability Assay
-
RT-PCR
Biologische Aktivität
Beschreibung
In Vitro
Exendin-4 binds to and activates human and rat GLP-1 receptors with affinity and potency comparable to those of GLP-1; it directly enhances glucose-stimulated insulin secretion in vitro from islets isolated from male Lewis rats; it induces the differentiation of AR42J pancreatic acinar cells into insulin-, pancreatic polypeptide- and glucagon-positive cells[1].
Exendin-4 inhibits apoptosis induced by pro-apoptotic cytokines by an average of 44% in FACS-purified rat β cells[1].
Exendin-4 enhances the sensitivity of differentiated 3T3-L1 adipocytes to insulin-dependent glucose uptake; it increases insulin secretion by confluent nestin-positive islet-derived progenitor cells by 2 to 3-fold[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
In Vivo
Exendin-4 (administered via intraperitoneal injection at doses ranging from 0.1 μg to 100 μg per rat, twice daily for 5-6 weeks) reduces A1C by 41.3% and improves insulin sensitivity by 76% in obese diabetic ZDF rats; dose-dependent benefits are observed even at a dose of 0.1 μg per rat administered twice daily for 6 weeks[1].
Exendin-4 (100 μg/kg; subcutaneous injection; single administration) produces a maximum 37% reduction in plasma glucose levels in fasted diabetic rhesus monkeys, with an ED50 of 0.25 μg/kg[1].
Exendin-4 (0.4 nmol/kg; intravenous injection; single administration) exhibits potent glucose-dependent insulinotropic activity in fasted Wistar rats, with an ED50 of 0.014 nmol/kg[1].
Exendin-4 (i.p.; once daily; for 10 consecutive days at a dose of 1 nmol/kg) attenuates the progression of diabetes in pancreatectomized rats, reduces their blood glucose levels by 40% compared with untreated rats, and increases β-cell mass by 40% via β-cell differentiation and proliferation[1].
Exendin-4 (3 μg/kg/day; subcutaneous injection; once daily; postnatal days 2-6) increases pancreatic insulin content and β-cell mass in newborn prediabetic GK rats on postnatal day 7, and reduces fasting blood glucose levels at 2 months of age[1].
Exendin-4 (3 μg/kg; i.p.; once daily; postnatal days 2-6) increases the β-cell mass of neonatal Wistar rats treated with Streptozotocin (HY-13753) to 71% of the healthy level on day 7[1].
Exendin-4 (intraperitoneal injection, once daily, on postnatal days 1-6, at a dose of 1 nmol/kg) prevents impaired glucose tolerance in neonatal rats with intrauterine growth restriction (IUGR), maintains their normal fasting blood glucose levels and β-cell mass until 8 months after birth, and restores β-cell proliferation capacity and PDX-1 expression to normal levels[1].
Exendin-4 (100 μg/kg, subcutaneous injection, twice daily for 15 consecutive days) reduces blood glucose levels in diabetic db/db mice by promoting β-cell proliferation, and increases their β-cell mass by 30%-60%[1].
Exendin-4 (1 nmol/kg; i.p.; once daily; for 2 weeks) reduces fasting blood glucose levels, improves oral glucose tolerance, and increases β-cell mass by 1.4-fold in diabetic db/db mice[1].
Exendin-4 (100 pmol/kg-1 nmol/kg; i.p.; once daily; for 2 consecutive weeks) reduces blood glucose levels in both healthy and diabetic mice, increases insulin secretion, lowers A1C levels by 20%-45%, and promotes β-cell neogenesis and PDX-1 expression in normoglycemic mice[1].
Exendin-4 (24 nmol/kg; i.p.; once daily; initiated 2 days before Streptozotocin injection and continued until 3 days after injection) reduces the β-cell apoptosis rate by 76% in C57Bl/6 mice, decreases blood glucose levels, and maintains high plasma insulin levels for up to 55 days after Streptozotocin injection[1].
Exendin-4 (0.1-100 μg; i.p.; twice daily; for 6 weeks) dose-dependently reduces food intake (ED50 0.14 μg) and body weight (ED50 0.42 μg) in obese diabetic Zucker rats, and sustained benefits for glycemic control and fat deposition are observed over a 56-day treatment period[1].
Exendin-4 (10 μg; administered via tail vein; single dose; administered immediately after reperfusion) reduces cerebral infarction volume by approximately 47% in male C57BL/6 mice with ischemic stroke at 24 h, improves neurological function, inhibits oxidative stress and inflammatory responses, reduces cell death, and increases intracellular cyclic AMP and phosphorylated CREB levels[2].
Exendin-4 (0.1 μM; subcutaneous injection; daily administration; throughout the entire study period) restores glycemic control, ameliorates pancreatic and brain pathology, enhances motor function, and increases survival rate by 18% in mouse models of Huntington's disease, while inducing moderate blood glucose reduction and motor function improvement in wild-type mice[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Clinical Trial
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS. Nr. 141758-74-9
-
Appearance Solid
-
Molecular Weight 4186.57
-
Formel C184H282N50O60S
-
Color White to off-white
-
Synonyms
Exenatide
-
Sequence
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
-
Sequence Shortening
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 2 years; -20°C, 1 year (sealed storage, away from moisture and light, under nitrogen)
Publications (72)
-
Journal Impact Factor
-
Most Recent
-
Nature
2025 May;641(8061):192-201. PMID: 40044869 -
Cell Metab
Gut enteroendocrine cell activation using a combination of GPR119 and GPR40 agonists results in synergistic hormone secretion in mice and humans. [Abstract]2026 Jan 6;38(1):50-64.e12. PMID: 41338185 -
Cell Metab
2025 Dec 2;37(12):2362-2380.e8. PMID: 41265449 -
Gut
6α-hydroxylated bile acids mediate TGR5 signalling to improve glucose metabolism upon dietary fiber supplementation in mice. [Abstract]2023 Feb;72(2):314-324. PMID: 35697422
Exendin-4 purchased from MedChemExpress. Usage Cited in: Gut. 2023 Feb;72(2):314-324. [Abstract]
Exendin-4 (2 nmol/kg/day) supplementation improves the metabolic defect of TGR5 KO fed western-style diet (WSD) enriched with oligofructose (OFS).
-
Bioact Mater
Food-derived β-lactoglobulin nanofibrils: An efficacy, safe, and scalable solution to overcome oral insulin delivery challenges. [Abstract]2025 Nov 25:57:646-659. PMID: 41377894
Exendin-4 purchased from MedChemExpress. Usage Cited in: Bioact Mater. 2025 Nov 25:57:646-659. [Abstract]
Pharmacokinetics of Exendin-4 following oral versus subcutaneous administration in mice. (a) Experimental design: Fasted mice received either (i) oral PBS + exendin-4 capsule (1 mg/kg), (ii) oral nanofibrils (20 mg/mL, 200 µL) + exendin-4 capsule (1 mg/kg), or (iii) subcutaneous exendin-4 (0.1 mg/kg, pharmacological control). (b) Serum exendin-4 levels over 6 hours. (c) Corresponding AUC analysis (0-6 h).
-
J Adv Res
Discovery and identification of semaphorin 4D as a bioindicator of high fracture incidence in type 2 diabetic mice with glucose control. [Abstract]2025 Mar 10:S2090-1232(25)00174-2. PMID: 40073972
Exendin-4 purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Mar 10:S2090-1232(25)00174-2. [Abstract]
Micro-CT images representing trabecular formation in control mice, mice with T2DM, mice with T2DM treated with Exendin-4 (20 mg/kg)/Metformin, and GLP-1R knockout mice with T2DM treated with Exendin-4 within a region of interest (ROI). n=6 mice per group. Con: control; T2DM: type 2 diabetes mellitus; Met: metformin; Ex-4: Exendin-4; Micro-CT: micro-computed tomography.
-
-
Biomaterials
Effective oral delivery of Exenatide-Zn2+ complex through distal ileum-targeted double layers nanocarriers modified with deoxycholic acid and glycocholic acid in diabetes therapy. [Abstract]2021 Aug:275:120944. PMID: 34153783 -
Asian J Pharm Sci
Functionalized lipid nanoparticles modulate the blood-brain barrier and eliminate α-synuclein to repair dopamine neurons. [Abstract]2024 Apr;19(2):100904. PMID: 38601010 -
Int J Biol Sci
Activation of glucagon-like peptide-1 receptor in microglia attenuates neuroinflammation-induced glial scarring via rescuing Arf and Rho GAP adapter protein 3 expressions after nerve injury. [Abstract]2022 Jan 16;18(4):1328-1346. PMID: 35280691 -
J Neuroinflammation
The glucagon-like peptide-1 receptor agonist reduces inflammation and blood-brain barrier breakdown in an astrocyte-dependent manner in experimental stroke. [Abstract]2019 Nov 28;16(1):242. PMID: 31779652 -
Int J Nanomedicine
Aptamer Functionalized Liposomes Co-Loaded with Exenatide-4 and Coenzyme Q10 Ameliorate Type 2 Diabetes Mellitus by Improving Pancreatic β Cell Function. [Abstract]2025 Mar 17:20:3363-3378. PMID: 40125440 -
Neural Regen Res
Exendin-4 and linagliptin attenuate neuroinflammation in a mouse model of Parkinson's disease. [Abstract]2023 Aug;18(8):1818-1826. PMID: 36751811 -
Mol Med
Glucagon-like peptide-1 receptor agonist exendin 4 ameliorates diabetes-associated vascular calcification by regulating mitophagy through the AMPK signaling pathway. [Abstract]2024 May 8;30(1):58. PMID: 38720283 -
Drug Deliv
Construction and performance of exendin-4-loaded chitosan-PLGA microspheres for enhancing implant osseointegration in type 2 diabetic rats. [Abstract]2022 Dec;29(1):548-560. PMID: 35156499 -
Br J Pharmacol
The flavonoid resokaempferol improves insulin secretion from healthy and dysfunctional pancreatic β-cells. [Abstract]2025 Jan;182(1):52-68. PMID: 39327688 -
Br J Pharmacol
Role of LRP5/6/GSK-3β/β-catenin in the differences in exenatide- and insulin-promoted T2D osteogenesis and osteomodulation. [Abstract]2024 Oct;181(19):3556-3575. PMID: 38804080 -
Br J Pharmacol
Exendin-4, a GLP-1 receptor agonist regulates retinal capillary tone and restores microvascular patency after ischaemia-reperfusion injury. [Abstract]2020 Aug;177(15):3389-3402. PMID: 32232832 -
J Invest Dermatol
Adipocyte-Derived CTRP3 Exhibits Anti-Inflammatory Effects via LAMP1-STAT3 Axis in Psoriasis. [Abstract]2022 May;142(5):1349-1359.e8. PMID: 34687744 -
Biochem Pharmacol
Single-cell RNA sequencing reveals beneficial mechanisms of Exendin-4 in autoimmune uveitis. [Abstract]2025 Oct 30;243(Pt 1):117483. PMID: 41173056 -
Biochem Pharmacol
Exendin-4 Prevents oxLDL-Induced upregulation of TREM2 and attenuates foam cell formation and inflammation in Macrophages. [Abstract]2025 Sep 4;242(Pt 2):117306. PMID: 40914218 -
Mol Metab
2026 Jun 18:110:102403. PMID: 42314903 -
Mol Metab
Deletion of Ascl1 in pancreatic β-cells improves insulin secretion, promotes parasympathetic innervation, and attenuates dedifferentiation during metabolic stress. [Abstract]2023 Dec:78:101811. PMID: 37769990 -
J Mater Chem B
2026 Apr 29;14(16):5051-5065. PMID: 41978477 -
Inflamm Res
Exendin-4 blockade of T1R2/T1R3 activation improves Pseudomonas aeruginosa-related pneumonia in an animal model of chemically induced diabetes. [Abstract]2024 Jul;73(7):1185-1201. PMID: 38748233 -
Biomacromolecules
Poly(l-threonine- co-l-threonine Succinate) Thermogels for Sustained Release of Lixisenatide. [Abstract]2024 Aug 12;25(8):4946-4955. PMID: 38949062 -
Eur J Pharmacol
Exendin-4 promotes ischemia-reperfusion flap survival by upregulating Gpx4 to inhibit ferroptosis. [Abstract]2024 Dec 5:984:177029. PMID: 39366501 -
Eur J Pharmacol
Exendin-4, a glucagon-like peptide-1 receptor agonist, regulates ductus arteriosus by vasodilation and anti-remodeling through the PKA pathway. [Abstract]2024 Dec 15:985:177106. PMID: 39515563 -
-
Int Immunopharmacol
Exendin-4 intervention attenuates atherosclerosis severity by modulating myeloid-derived suppressor cells and inflammatory cytokines in ApoE-/- mice. [Abstract]2024 Oct 25:140:112844. PMID: 39094363 -
Int Immunopharmacol
Exenatide improves hypogonadism and attenuates inflammation in diabetic mice by modulating gut microbiota. [Abstract]2023 Jul:120:110339. PMID: 37210914 -
Int Immunopharmacol
Exenatide inhibits necrosis by enhancing angiogenesis and ameliorating ischemia/reperfusion injury in a random skin flap rat model. [Abstract]2021 Jan:90:107192. PMID: 33214096 -
Am J Physiol Cell Physiol
Reduced Incretin Receptor Trafficking upon Activation Enhances Glycemic Control and Reverses Obesity in Diet-Induced Obese Mice. [Abstract]2024 Jul 1;327(1):C74-C96. PMID: 38738303 -
Front Pharmacol
Glucagon-Like Peptide-1 Analog Exendin-4 Ameliorates Cocaine-Mediated Behavior by Inhibiting Toll-Like Receptor 4 Signaling in Mice. [Abstract]2021 Jul 19;12:694476. PMID: 34349653 -
BMC Biol
2021 Mar 3;19(1):40. PMID: 33658023 -
Front Pharmacol
GLP-1 Receptor Activation Abrogates β-Cell Dysfunction by PKA Cα-Mediated Degradation of Thioredoxin Interacting Protein. [Abstract]2019 Oct 25:10:1230. PMID: 31708773
Exendin-4 purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2019 Oct 25:10:1230. [Abstract]
Exendin-4 or FSK treatment reduces ER stress-induced β-cell viability. INS-1 cells are incubated with THAP (0.5 μM), with Eexendin-4.
Exendin-4 purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2019 Oct 25:10:1230. [Abstract]
INS-1 cells are incubated with THAP (0.5 μM), H89, with Exendin-4 or FSK at indicated concentration for 24 h, then the IL-1β level is analyzed by qRT-PCR (n = 3).
-
Chem Biol Interact
Exenatide alleviates adriamycin-induced heart dysfunction in mice: Modulation of oxidative stress, apoptosis and inflammation. [Abstract]2019 May 1:304:186-193. PMID: 30885636 -
Sci Rep
Liraglutide exhibits potential anti-tumor effects on the progression of intrahepatic cholangiocarcinoma, in vitro and in vivo. [Abstract]2024 Jun 14;14(1):13726. PMID: 38877189 -
Sci Rep
The dual DPP4 inhibitor and GPR119 agonist HBK001 regulates glycemic control and beta cell function ex and in vivo. [Abstract]2017 Jun 28;7(1):4351. PMID: 28659588 -
Structure
2022 Apr 7;30(4):510-521.e3. PMID: 35148829 -
Biomedicines
Exosome-Mediated Differentiation of Mouse Embryonic Fibroblasts and Exocrine Cells into β-Like Cells and the Identification of Key miRNAs for Differentiation. [Abstract]2020 Nov 9;8(11):485. PMID: 33182285 -
Acta Biochim Biophys Sin (Shanghai)
Lithium and an EPAC-specific inhibitor ESI-09 synergistically suppress pancreatic cancer cell proliferation and survival. [Abstract]2017 Jul 1;49(7):573-580. PMID: 28475672 -
Biochim Biophys Acta Mol Cell Res
GLP-1 regulates exercise endurance and skeletal muscle remodeling via GLP-1R/AMPK pathway. [Abstract]2022 May 27;1869(9):119300. PMID: 35636559 -
Am J Physiol Endocrinol Metab
GLP-1 receptor agonist exendin-4 suppresses food intake by inhibiting hindbrain orexigenic NPY neurons. [Abstract]2025 Mar 24. PMID: 40126941 -
Am J Physiol Endocrinol Metab
Glucagon-like peptide-1 alleviates diabetic kidney disease through activation of autophagy by regulating AMP-activated protein kinase-mammalian target of rapamycin pathway. [Abstract]2020 Dec 1;319(6):E1019-E1030. PMID: 32985256 -
J Biol Chem
Complement 1q-like-3 protein inhibits insulin secretion from pancreatic β-cells via the cell adhesion G protein-coupled receptor BAI3. [Abstract]2018 Nov 23;293(47):18086-18098. PMID: 30228187 -
-
-
J Cell Physiol
Exenatide improves random-pattern skin flap survival via TFE3 mediated autophagy augment. [Abstract]2021 May;236(5):3641-3659. PMID: 33044023 -
ACS Med Chem Lett
In Vitro Characterization of Agonist and Antagonist Peptide Binding Interaction Kinetics to GLP-1R in HEK293T Cells Using Surface Plasmon Resonance Microscopy. [Abstract]2026 May 4;17(5):963-972. PMID: 42157826 -
-
Exp Cell Res
Exendin-4 alleviates myocardial ischemia reperfusion injury by enhancing autophagy through promoting nuclear translocation of TFEB. [Abstract]2023 Feb 15;423(2):113469. PMID: 36627100 -
J Diabetes Res
Exendin-4 Protects against Hyperglycemia-Induced Cardiomyocyte Pyroptosis via the AMPK-TXNIP Pathway. [Abstract]2019 Dec 9:2019:8905917. PMID: 31886288 -
Front Behav Neurosci
Effects of Glucagon-Like Peptide-1 Receptor Agonist Exendin-4 on the Reinstatement of Cocaine-Mediated Conditioned Place Preference in Mice. [Abstract]2022 Jan 5:15:769664. PMID: 35069139 -
Neuroscience
Exenatide attenuates neuroinflammation and rescues sepsis-induced depressive behavior and cognitive dysfunction in a mouse model. [Abstract]2026 Apr 16:600:112-129. PMID: 41747818 -
Gerontology
Activation of the Vascular Smooth Muscle GLP-1/NCX1 Pathway Regulates Cytoplasmic Ca2+ Homeostasis and Improves Blood Pressure Variability in Hypertension. [Abstract]2023;69(5):603-614. PMID: 36882028 -
Insects
Exendin-4 Caused Growth Arrest by Regulating Sugar Metabolism in Hyphantria cunea (Lepidoptera: Erebidae) Larvae. [Abstract]2024 Jul 5;15(7):503. PMID: 39057236 -
Neurogastroenterol Motil
2019 Feb;31(2):e13482. PMID: 30303298 -
PLoS One
Exendin-4 enhances GLP-1 signaling and reduces anxiety-like behaviors in male heroin withdrawal mice. [Abstract]2026 Mar 12;21(3):e0343995. PMID: 41818251 -
J Mol Histol
Exendin-4 alleviates diabetic retinopathy by activating autophagy via regulation of the adenosine monophosphate-activated protein kinase/sirtuin 1 pathway. [Abstract]2025 Jun 28;56(4):210. PMID: 40580219 -
Diabetol Int
2025 Jun 5;16(3):568-579. PMID: 40607156 -
bioRxiv
Protease-Resistant Azapeptide GLP-1 Analogue Improves Metabolic Control in Diet-Induced Obesity. [Abstract]2025 Nov 18:2025.05.09.653092. PMID: 41278761 -
-
-
-
-
-
bioRxiv
An shRNA screen in primary human beta cells identifies the serotonin 1F receptor as a negative regulator of survival during transplant. [Abstract]2024 May 3:2024.05.01.591950. PMID: 38746433 -
bioRxiv
Incretin hormones and pharmacomimetics rapidly inhibit AgRP neuron activity to suppress appetite. [Abstract]2024 Mar 20:2024.03.18.585583. PMID: 38562891 -
-
-
Lösungsmittel & Löslichkeit
In Vitro:
DMSO : 100 mg/mL (23.89 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 33.33 mg/mL (7.96 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 2 years; -20°C, 1 year (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 2 years. When stored at -20°C, please use it within 1 year.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 2 years; -20°C, 1 year (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 2 years. When stored at -20°C, please use it within 1 year.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Protokoll
-
RNA extraction experimental
By lysing cells, releasing RNA, and removing impurities such as proteins and DNA, high-purity RNA products are finally obtained. The commonly used traditional method is the guanidine isothiocyanate/phenol/chloroform method (Trizol), which is suitable for a variety of animal materials including animal tissues, microorganisms, cultured cells, etc., and most plant materials.
-
Apoptosis
Apoptosis, also called programmed cell death, is generally characterized by distinct morphological characteristics.
-
TUNEL staining for apoptotic DNA fragmentation
TUNEL staining detects DNA strand breaks by using terminal deoxynucleotidyl transferase to add labeled nucleotides to exposed 3′-OH DNA termini, generating either microscopic staining in fixed cells or tissue sections, or fluorescence/cytometric signal in cell suspensions. TUNEL positivity reflects DNA fragmentation but should not be interpreted alone as definitive apoptosis, because TUNEL can also label necrotic, autolytic, mechanically damaged, or DNA-repair-associated DNA breaks.
-
Annexin V plus membrane-impermeant dye apoptosis staining
Annexin V-based apoptosis assays rely on the detection of phosphatidylserine (PS) externalization from the inner leaflet of the plasma membrane to the outer leaflet, an early biochemical hallmark of apoptosis. Fluorescently labeled Annexin V binds PS in a calcium-dependent manner, enabling identification of early apoptotic cells by flow cytometry or fluorescence microscopy. When combined with a membrane-impermeant DNA-binding dye (e. g. , propidium iodide), this approach allows discrimination between viable (Annexin V−/dye−), early apoptotic (Annexin V+/dye−), and late apoptotic or necrotic (Annexin V+/dye+) cell populations by assessing membrane integrity and PS exposure.
-
ROS/oxidative-stress fluorescent staining
ROS/oxidative-stress fluorescent staining uses cell-permeant fluorogenic probes that become fluorescent after oxidation inside cells or tissues; commonly used examples include DCFH-DA/DCFDA for broad cellular oxidant detection, DHE for superoxide-related signal detection, MitoSOX for mitochondrial superoxide-related signal detection, and CellROX probes for oxidative-stress-associated fluorescence readouts. The assay detects probe oxidation rather than a single ROS species unless the probe and analysis method have been chemically validated for that species. DCFH-DA enters cells, is deacetylated by intracellular esterases to DCFH, and produces fluorescent DCF after oxidation, so the readout is used as an operational measure of total cellular oxidative stress rather than a species-specific ROS measurement. DHE and MitoSOX can report superoxide-related oxidation, but red fluorescence alone can include non-specific ethidium-like oxidation products; HPLC or optimized spectral approaches are
-
Research Protocol for Endocrine Diseases
Endocrine diseases often arise from disrupted hormone production, hormone signaling, or target-tissue responsiveness; for diabetes-focused endocrine disease models, insulin signaling regulates glucose uptake, hepatic glucose output, lipid metabolism, and β-cell compensation. Type 2 diabetes develops through interacting defects in insulin resistance, β-cell dysfunction, adipose inflammation, hepatic glucose overproduction, altered incretin signaling, and ectopic lipid metabolism. A major unresolved question is whether endocrine dysfunction is driven primarily by target-tissue insulin resistance, intrinsic β-cell failure, immune/inflammatory stress, or combined multi-organ failure that differs by disease stage.
-
Human Islet Cell Culture
The method of preserving islets in vitro, with purified reduced immunogenicity. The steps are islet isolation, islet cell purification, in vitro determination of islet function and islet cell culture.
-
Apoptosis Solutions
Apoptosis is a regulated, generally non-lytic cell-death pathway that removes unwanted, damaged, infected, or abnormal cells through coordinated morphological changes, caspase activation, DNA fragmentation, and membrane remodeling. The intrinsic apoptosis pathway is controlled mainly by mitochondrial outer membrane permeabilization, BCL-2 family proteins, cytochrome c release, apoptosome formation, caspase-9 activation, and downstream executioner caspase-3/7 activation. The extrinsic apoptosis pathway is initiated by death receptors such as Fas, TNFR, and TRAIL receptors, which recruit adaptor proteins and activate caspase-8 before engaging executioner caspases or mitochondrial amplification through BID cleavage. Apoptosis is linked to many phenotypes, including cancer cell killing, tissue homeostasis, immune regulation, neurodegeneration, infection response, and treatment-induced cytotoxicity; unresolved questions include how apoptosis interacts with necroptosis, pyroptosis, ferroptos
-
Research Protocol for Metabolic Diseases
AMP-activated protein kinase, AMPK, is a conserved cellular energy sensor that responds to reduced cellular energy status and coordinates metabolism by increasing ATP-generating catabolic pathways while suppressing ATP-consuming anabolic processes. In metabolic disease research, the AMPK pathway is experimentally relevant because it regulates hepatic lipid synthesis, fatty acid oxidation, glucose production, skeletal-muscle glucose disposal, mTORC1-linked biosynthesis, autophagy, mitochondrial homeostasis, and whole-body energy balance. The central pathway logic is that energy stress, metformin, exercise-like stimulation, or direct AMPK activators increase AMPKα Thr172 phosphorylation and downstream substrate phosphorylation, including ACC and RAPTOR. Phosphorylation of ACC suppresses lipogenesis and supports fatty acid oxidation, whereas phosphorylation of RAPTOR suppresses mTORC1 signaling and links cellular energy status to growth and protein synthesis control. The pathway is linked
Reinheit & Dokumentation
-
Data Sheet (311 KB)
-
SDS (420 KB)
- English - EN (420 KB)
- Français - FR (420 KB)
- Deutsch - DE (420 KB)
- Norwegian - NO (420 KB)
- Español - ES (420 KB)
- Swedish - SV (420 KB)
- Italian - IT (420 KB)
- Korean - KR (420 KB)
- Portuguese - PT (420 KB)
-
Handling Instructions (2659 KB)
Verweise
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 2 years; -20°C, 1 year (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 2 years. When stored at -20°C, please use it within 1 year.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2389 mL | 1.1943 mL | 2.3886 mL | 5.9715 mL |
| 5 mM | 0.0478 mL | 0.2389 mL | 0.4777 mL | 1.1943 mL | |
| DMSO | 10 mM | 0.0239 mL | 0.1194 mL | 0.2389 mL | 0.5971 mL |
| 15 mM | 0.0159 mL | 0.0796 mL | 0.1592 mL | 0.3981 mL | |
| 20 mM | 0.0119 mL | 0.0597 mL | 0.1194 mL | 0.2986 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.