1. GPCR/G Protein
  2. Glucagon Receptor
  3. Exendin (5-39)

Exendin (5-39) 

Cat. No.: HY-P2497
Handling Instructions

Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Exendin (5-39) Chemical Structure

Exendin (5-39) Chemical Structure

CAS No. : 196109-27-0

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats[1].

IC50 & Target

IC50: GLP-1 receptor[1]

In Vivo

Exendin (5-39) (intracerebroventricular injection; 0.3 μg; once daily; 1-week) increases GLT-1 protein levels in the hippocampus of male Wistar rats. Additionally, hippocampal slices are prepared from Ex-treated or vehicle rats,Exendin (5-39) decreases fEPSP decay time and increases the input-output relation and decreased the paired-pulse ratio in the dentate gyrus (DG). Furthermore, Ex inhibits long-term depression but not long-term potentiation in the DG[1].

Animal Model: Wistar rats (3 weeks old and 18 days pregnant)[1]
Dosage: 0.3 μg
Administration: Intracerebroventricular injection; 0.3 μg; once daily; 1-week
Result: Inhibited GLT-1 protein levels and inhibited long-term depression in rats.
Molecular Weight

3806.30

Formula

C₁₆₉H₂₆₂N₄₄O₅₄S

CAS No.

196109-27-0

Sequence Shortening

TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Exendin (5-39)Glucagon ReceptorGCGRGLP-1 receptorimpairmentdepressiondentate gyrusInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin (5-39)
Cat. No.:
HY-P2497
Quantity:
MCE Japan Authorized Agent: