1. GPCR/G Protein
  2. GCGR
  3. Exendin (5-39)

Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Exendin (5-39) Chemical Structure

Exendin (5-39) Chemical Structure

CAS No. : 196109-27-0

Size Price Stock Quantity
1 mg USD 260 In-stock
5 mg USD 580 In-stock
10 mg USD 950 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Exendin (5-39)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats[1].

IC50 & Target

IC50: GLP-1 receptor[1]

In Vivo

Exendin (5-39) (intracerebroventricular injection; 0.3 μg; once daily; 1-week) increases GLT-1 protein levels in the hippocampus of male Wistar rats. Additionally, hippocampal slices are prepared from Ex-treated or vehicle rats,Exendin (5-39) decreases fEPSP decay time and increases the input-output relation and decreased the paired-pulse ratio in the dentate gyrus (DG). Furthermore, Ex inhibits long-term depression but not long-term potentiation in the DG[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Wistar rats (3 weeks old and 18 days pregnant)[1]
Dosage: 0.3 μg
Administration: Intracerebroventricular injection; 0.3 μg; once daily; 1-week
Result: Inhibited GLT-1 protein levels and inhibited long-term depression in rats.
Molecular Weight

3806.30

Formula

C169H262N44O54S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Sequence Shortening

TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Exendin (5-39) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin (5-39)
Cat. No.:
HY-P2497
Quantity:
MCE Japan Authorized Agent: