Defensin HNP-3 human

Name: Defensin HNP-3 human
Brand: MedChemExpress
SKU: HY-P2302
Rating: 4.5 (0 reviews)

Cat. No.: HY-P2302 Purity: 97.59%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

Defensin HNP-3 human is an α-defensin stored in the azurophilic granules of human neutrophils. Defensin HNP-3 human exerts broad-spectrum bactericidal, antifungal and antiviral activities mainly by forming bacterial membrane pores, and acts as a chemoattractant for monocytes and T cells. Defensin HNP-3 human maintains epithelial integrity to support periodontal tissue homeostasis, and exerts concentration-dependent effects on epithelial cell proliferation, adhesion and bacterial adhesion. Defensin HNP-3 human targets solid tumors and leukemia by inducing single-strand DNA breaks and membrane permeabilization in tumor cells via electrostatic binding and pore formation. Defensin HNP-3 human is abundant in human tongue squamous cell carcinoma and neutrophils infiltrating oral squamous cell carcinoma. Defensin HNP-3 human can be applied to research related to periodontitis and human tongue squamous cell carcinoma.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Defensin HNP-3 human Chemical Structure

CAS No. : 136661-76-2

Size	Stock	Quantity
100 μg	In-stock	Estimated Time of Arrival: December 31
500 μg	In-stock	Estimated Time of Arrival: December 31
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Antibiotic Isoform Specific Products:

View All Isoforms

Aminoglycoside Glycopeptide Lipopeptide Macrolide Oxazolidinone Quinolone Tetracycline β-lactam

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Defensin HNP-3 human (8 mL acidified ethanol per g tissue; overnight, 20 min, 80 min) is present at 2- to 12-fold higher levels in human tongue oral squamous cell carcinoma tissue compared to paired autogenous non-tumour tongue tissue, and is localized to abundant neutrophils within tumour and stromal regions^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3486.04

Formula

C₁₅₁H₂₂₂N₄₄O₄₀S₆

CAS No.

136661-76-2

Appearance

Solid

Color

White to off-white

Sequence

Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Sequence Shortening

DCYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : 100 mg/mL (28.69 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2869 mL	1.4343 mL	2.8686 mL
5 mM	0.0574 mL	0.2869 mL	0.5737 mL
10 mM	0.0287 mL	0.1434 mL	0.2869 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 97.59%

Select Batch:

Data Sheet (275 KB) SDS (254 KB)

COA (250 KB) RP-HPLC (110 KB) MS (213 KB)

Handling Instructions (2659 KB)

References

[1]. Lundy FT, et al. Identification and overexpression of human neutrophil alpha-defensins (human neutrophil peptides 1, 2 and 3) in squamous cell carcinomas of the human tongue. Oral Oncol. 2004;40(2):139-144. [Content Brief]

[2]. Gursoy U K, et al. Human neutrophil defensins and their effect on epithelial cells[J]. Journal of periodontology, 2013, 84(1): 126-133.

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2869 mL	1.4343 mL	2.8686 mL	7.1715 mL
	5 mM	0.0574 mL	0.2869 mL	0.5737 mL	1.4343 mL
	10 mM	0.0287 mL	0.1434 mL	0.2869 mL	0.7171 mL
	15 mM	0.0191 mL	0.0956 mL	0.1912 mL	0.4781 mL
	20 mM	0.0143 mL	0.0717 mL	0.1434 mL	0.3586 mL
	25 mM	0.0115 mL	0.0574 mL	0.1147 mL	0.2869 mL