Defensin HNP-3 human
Based on 1 Customer Validation
Defensin HNP-3 human is an α-defensin stored in the azurophilic granules of human neutrophils. Defensin HNP-3 human exerts broad-spectrum bactericidal, antifungal and antiviral activities mainly by forming bacterial membrane pores, and acts as a chemoattractant for monocytes and T cells. Defensin HNP-3 human maintains epithelial integrity to support periodontal tissue homeostasis, and exerts concentration-dependent effects on epithelial cell proliferation, adhesion and bacterial adhesion. Defensin HNP-3 human targets solid tumors and leukemia by inducing single-strand DNA breaks and membrane permeabilization in tumor cells via electrostatic binding and pore formation. Defensin HNP-3 human is abundant in human tongue squamous cell carcinoma and neutrophils infiltrating oral squamous cell carcinoma. Defensin HNP-3 human can be applied to research related to periodontitis and human tongue squamous cell carcinoma.
For research use only. We do not sell to patients.
- Purity: 97.59%
- CAS No.: 136661-76-2
- Formula: C151H222N44O40S6
- Molecular Weight:3486.04
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
All Antibiotic Isoforms
More
Biological Activity
Description
In Vitro
Defensin HNP-3 human (8 mL acidified ethanol per g tissue; overnight, 20 min, 80 min) is present at 2- to 12-fold higher levels in human tongue oral squamous cell carcinoma tissue compared to paired autogenous non-tumour tongue tissue, and is localized to abundant neutrophils within tumour and stromal regions[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 136661-76-2
-
Appearance Solid
-
Molecular Weight 3486.04
-
Formula C151H222N44O40S6
-
Color White to off-white
-
Sequence
Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)
-
Sequence Shortening
DCYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (28.69 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (275 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2869 mL | 1.4343 mL | 2.8686 mL | 7.1715 mL |
| 5 mM | 0.0574 mL | 0.2869 mL | 0.5737 mL | 1.4343 mL | |
| 10 mM | 0.0287 mL | 0.1434 mL | 0.2869 mL | 0.7171 mL | |
| 15 mM | 0.0191 mL | 0.0956 mL | 0.1912 mL | 0.4781 mL | |
| 20 mM | 0.0143 mL | 0.0717 mL | 0.1434 mL | 0.3586 mL | |
| 25 mM | 0.0115 mL | 0.0574 mL | 0.1147 mL | 0.2869 mL |