1. Membrane Transporter/Ion Channel
    Neuronal Signaling
  2. Calcium Channel
    Sodium Channel
    Potassium Channel
  3. ProTx-I

ProTx-I 

Cat. No.: HY-P1073
Handling Instructions

ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na+ channels and inhibits KV 2.1 channels.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ProTx-I Chemical Structure

ProTx-I Chemical Structure

CAS No. : 484598-35-8

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na+ channels and inhibits KV 2.1 channels[1][2].

IC50 & Target

IC50: 0.2 μM (hCaV3.1) and 31.8 μM (hCaV3.2)[1]
Na+ channels[2]
KV 2.1 channels[2]

Molecular Weight

3988.00

Formula

₄₈₄₅₉₈-₃₅-₈

CAS No.

484598-35-8

Sequence

Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Ala-Gly-Gln-Thr-Cys-Cys-Lys-His-Leu-Val-Cys-Ser-Arg-Arg-His-Gly-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe-Ser (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28)

Sequence Shortening

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

ProTx-ICalcium ChannelSodium ChannelPotassium ChannelCa2+ channelsCa channelsNa channelsNa+ channelsKcsACaV3.1toxinNaV1.8KV2.1proliferativevoltage-gatedInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ProTx-I
Cat. No.:
HY-P1073
Quantity:
MCE Japan Authorized Agent: