1. Membrane Transporter/Ion Channel Neuronal Signaling
  2. Calcium Channel Potassium Channel Sodium Channel TRP Channel
  3. ProTx-I

ProTx-I is a toxin derived from Thrixopelma pruriens and a peptide inhibitor targeting TTX-resistant sodium channels. ProTx-I interacts with voltage sensors of multiple domains such as NaV1.7, reduces neuronal excitability through allosteric modulation of channel gating and alteration of voltage dependence. The IC50 values of ProTx-I against human NaV1.7, NaV1.2, NaV1.6, and NaV1.5 are 95 nM, 104 nM, 21 nM, and 358 nM, respectively; ProTx-I also potently inhibits Ba2+ currents of hCav3.1, while its inhibitory potency against hCav3.2 is approximately 160-fold lower. ProTx-I is applicable to the research of chronic pain.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ProTx-I

ProTx-I Chemical Structure

CAS No. : 484598-35-8

Size Price Stock Quantity
100 μg In-stock
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ProTx-I is a toxin derived from Thrixopelma pruriens and a peptide inhibitor targeting TTX-resistant sodium channels. ProTx-I interacts with voltage sensors of multiple domains such as NaV1.7, reduces neuronal excitability through allosteric modulation of channel gating and alteration of voltage dependence. The IC50 values of ProTx-I against human NaV1.7, NaV1.2, NaV1.6, and NaV1.5 are 95 nM, 104 nM, 21 nM, and 358 nM, respectively; ProTx-I also potently inhibits Ba2+ currents of hCav3.1, while its inhibitory potency against hCav3.2 is approximately 160-fold lower. ProTx-I is applicable to the research of chronic pain[1][2][3].

IC50 & Target

T-type calcium channel

 

Nav1.2

104 nM (IC50)

Nav1.6

21 nM (IC50)

Nav1.7

95 nM (IC50)

KV2.1

411 nM (IC50)

TRPA1

389 nM (IC50)

hNav1.5

358 nM (IC50)

In Vitro

ProTx-I (0.01-10 μM; ~7-30 min) potently inhibits Ba2+ currents through hCav3.1-expressing Xenopus laevis oocytes with an IC50 of 0.20 μM, causes voltage-dependent inhibition and a small positive shift in activation potential, and exhibits partial to nearly irreversible binding[2].
ProTx-I (0.1-10 μM; ~2-7 min) weakly inhibits Ba2+ currents through hCav3.2-expressing Xenopus laevis oocytes with an IC50 of 31.8 μM, does not alter channel activation properties, and exhibits fully reversible binding[2].
ProTx-I (multiple concentrations) shows drastically reduced sensitivity when the domain IV S3-S4 linker of hCav3.1 is replaced with that of hCav3.2, resulting in an IC50 of 17.8 μM in hCav3.1/S3S4-expressing Xenopus laevis oocytes[2].
ProTx-I (multiple concentrations) shows increased sensitivity when the domain IV S3-S4 linker of hCav3.2 is replaced with that of hCav3.1, resulting in an IC50 of 15.8 μM in hCav3.2/S3S4-expressing Xenopus laevis oocytes[2].
ProTx-I (70 nM) inhibits heterologously expressed Cav3.1 voltage-gated calcium channels by shifting their voltage dependence of activation to more positive potentials, with an apparent IC50 of 70 nM during weak depolarizations[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3987.49

Formula

C171H245N53O47S6

CAS No.
Appearance

Solid

Color

white

Sequence

Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Ala-Gly-Gln-Thr-Cys-Cys-Lys-His-Leu-Val-Cys-Ser-Arg-Arg-His-Gly-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe-Ser (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28)

Sequence Shortening

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (25.08 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2508 mL 1.2539 mL 2.5078 mL
5 mM 0.0502 mL 0.2508 mL 0.5016 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2508 mL 1.2539 mL 2.5078 mL 6.2696 mL
5 mM 0.0502 mL 0.2508 mL 0.5016 mL 1.2539 mL
10 mM 0.0251 mL 0.1254 mL 0.2508 mL 0.6270 mL
15 mM 0.0167 mL 0.0836 mL 0.1672 mL 0.4180 mL
20 mM 0.0125 mL 0.0627 mL 0.1254 mL 0.3135 mL
25 mM 0.0100 mL 0.0502 mL 0.1003 mL 0.2508 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ProTx-I
Cat. No.:
HY-P1073
Quantity:
MCE Japan Authorized Agent: