Search Result

Results for "

C-terminal peptide

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Amyloid-β (4) Amino Acid Derivatives (1) Amylin Receptor (1) Angiotensin Receptor (1) Apoptosis (3) Bacterial (7) Biochemical Assay Reagents (4) c-Myc (1) CCR (3) CD47 (1) CMV (1) Complement System (2) CTLA-4 (1) CXCR (2) DNA Alkylator/Crosslinker (1) Endogenous Metabolite (5) ERK (2) Exosomes (1) Fungal (1) GLP Receptor (1) HIV (3) HSP (1) HSV (1) iGluR (4) Insulin Receptor (1) JNK (2) Melanocortin Receptor (2) Mitochondrial Metabolism (1) Neuropeptide Y Receptor (1) Neurotensin Receptor (2) Potassium Channel (2) Secretin Receptor (2) Sodium Channel (1) Somatostatin Receptor (1) Src (1) Tau Protein (1) Transmembrane Glycoprotein (1)
By Research Areas:	Cancer (10) Endocrinology (4) Infection (5) Inflammation/Immunology (12) Metabolic Disease (11) Neurological Disease (14)

By Targets:

Amyloid-β (4)

Amino Acid Derivatives (1)

Amylin Receptor (1)

Angiotensin Receptor (1)

Apoptosis (3)

Bacterial (7)

Biochemical Assay Reagents (4)

c-Myc (1)

CCR (3)

CD47 (1)

CMV (1)

Complement System (2)

CTLA-4 (1)

CXCR (2)

DNA Alkylator/Crosslinker (1)

Endogenous Metabolite (5)

ERK (2)

Exosomes (1)

Fungal (1)

GLP Receptor (1)

HIV (3)

HSP (1)

HSV (1)

iGluR (4)

Insulin Receptor (1)

JNK (2)

Melanocortin Receptor (2)

Mitochondrial Metabolism (1)

Neuropeptide Y Receptor (1)

Neurotensin Receptor (2)

Potassium Channel (2)

Secretin Receptor (2)

Sodium Channel (1)

Somatostatin Receptor (1)

Src (1)

Tau Protein (1)

Transmembrane Glycoprotein (1)

By Research Areas:

Cancer (10)

Endocrinology (4)

Infection (5)

Inflammation/Immunology (12)

Metabolic Disease (11)

Neurological Disease (14)

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

Natural
Products

Targets Recommended: RXFP Receptor Formyl Peptide Receptor (FPR) Peptide-Drug Conjugates (PDCs) Natriuretic Peptide Receptor (NPR) Connective Peptide CGRP Receptor Amyloid-β

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P2746

Carboxypeptidase B, Porcine pancreas EC 3.4.2.2	Endogenous Metabolite	Metabolic Disease
Carboxypeptidase B, Porcine pancreas (EC 3.4.2.2) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues .

HY-P1465

Human secretin Secretin (28-54), (human)	Secretin Receptor	Metabolic Disease Cancer
Human secretin is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .

HY-W088929

H-Glu(OtBu)-NH2 hydrochloride	Amino Acid Derivatives	Others
H-Glu(OtBu)-NH2 hydrochloride is a specialized amino acid derivative that is crucial for the synthesis of peptides bearing a C-terminal glutamine amide.

HY-P0199

Pancreatic Polypeptide, human Human pancreatic polypeptide	Neuropeptide Y Receptor	Metabolic Disease Endocrinology
Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.

HY-P2535

GLP-1 (7-36), amide, biotin labeled GLP-1 (7-36)-Lys(biotin)-amide	GLP Receptor	Metabolic Disease
Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.

HY-E70201

Carboxypeptidase B (MS grade) EC 3.4.2.2 (MS grade)	Endogenous Metabolite	Others
Carboxypeptidase B (MS grade) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B (MS grade) is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B (MS grade) hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues .

HY-P0312

c-Myc Peptide TFA 1 Publications Verification	c-Myc	Cancer
c-Myc Peptide (TFA) is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription.

HY-P0144

Thrombospondin-1 (1016-1023) (human, bovine, mouse)	CD47 Apoptosis	Inflammation/Immunology
Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .

HY-P5124

β-Amyloid peptide(16-20) KLVFF	Amyloid-β	Neurological Disease
β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH₂ residues added at N- and C-terminal ends to aid solubility) .

HY-E70574

Trypsin/Lys-C complex protease (MS grade)	Biochemical Assay Reagents	Others
Trypsin/Lys-C complex protease (MS grade) combines Trypsin and Lys-C, two recombinant proteases, to achieve efficient peptide bond hydrolysis. Trypsin specifically cleaves the C-terminal peptide bonds of arginine (R) and lysine (K), while Lys-C specifically cleaves the C-terminal peptide bonds of lysine (K). This combination overcomes issues such as the slower digestion rate of lysine and arginine by rTrypsin, PTM changes on lysine, or hydrophobic C-termini (such as proline) that can lead to missed cleavage. Trypsin/Lys-C complex protease (MS grade) can be used to process complex protein samples that are difficult to enzymatically digest. Trypsin/Lys-C complex protease (MS grade) can be used for protein characterization, single-cell proteomics and large cohort proteomics studies.

HY-P2980

Carboxypeptidase A, Bovine pancreas EC 3.4.2.1	Endogenous Metabolite	Others
Carboxypeptidase A, Bovine pancreas (EC 3.4.2.1) is a zinc-containing metalloprotease, is often used in biochemical studies. Carboxypeptidase A catalyzes the hydrolysis of the peptide bonds that are adjacent to the C-terminal end of a polypeptide chain. Carboxypeptidase A is a prototypical enzyme for metalloproteases that plays important roles in biological systems .

HY-107024

Osteogenic Growth Peptide (10-14) OGP(10-14); Historphin	Src	Others
Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor .

HY-P5506

C5a Receptor agonist, W5Cha	Complement System	Others
C5a Receptor agonist, W5Cha (Peptide 1) is a selective complement C5a receptor (C5aR) agonist (EC₅₀=0.2 μM), a hexapeptide derived from the C-terminus of C5a with specific amino acid modifications. C5a Receptor agonist, W5Cha is able to interact with the Arg-206 site of the C5a receptor through its C-terminal arginine, thereby activating the receptor .

HY-W015461

2-Aminooctanoic acid DL-α-Aminocaprylic acid; DL-2-Aminocaprylic acid	Bacterial	Infection
2-Aminooctanoic acid (DL-α-Aminocaprylic acid) is a fatty acid with an amino functional group that can be directly coupled at both the C-terminal and N-terminal with antimicrobial peptides (AMP) derived from lactoferrin B to enhance antibacterial activity .

HY-P5391

LL-37(17-32)	Bacterial	Others
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)

HY-P1769

Angiotensin II (5-8), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (5-8), human is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II . Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P3982

CKLF1-C19	CCR	Inflammation/Immunology
CKLF1-C19 is the C-terminal peptide of human chemokine-like factor 1 (CKLF1). CKLF1-C19 interacts with CCR4, and inhibits chemotaxis induced by both CKLF1 and CCL17. CKLF1-C19 can suppress allergic lung inflammation via inhibiting chemotaxis mediated by CCR3 and CCR4 .

HY-P3418

CKLF1-C27	CCR ERK	Inflammation/Immunology
CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .

HY-P1465A

Human secretin TFA Secretin (28-54), (human) TFA	Secretin Receptor	Metabolic Disease Cancer
Human secretin TFA is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .

HY-P10300

CXCL8 (54-72) IL-8 (54-72)	CXCR	Inflammation/Immunology
CXCL8 (54-72) is a C-terminal peptide based on the chemokine CXCL8. CXCL8 (54-72) has an interaction between a long and highly positively charged C-terminal region and a negative charge on the GAG that binds to the GAG. CXCL8 (54-72) can inhibit the adhesion and migration of neutrophils and adhesion of endothelial cells. CXCL8 (54-72) can be used to study chemokines in inflammatory response .

HY-P5351A

Hyaluronan-binding peptide, biotin labeled TFA	Transmembrane Glycoprotein	Inflammation/Immunology Cancer
Hyaluronan-binding peptide, biotin labeled TFA is a biological active peptide. (This peptide is a hyaluronan-binding peptide biotinylated through a C-terminal GGGSK linker. Hyaluronan (HA) is a nonsulfated glycosaminoglycan expressed in the extracellular matrix and on cell surfaces. HA plays a role in fertilization, embryonic development, wound healing, angiogenesis, leukocyte trafficking to inflamed tissues, and cancer metastasis. This peptide has been shown to block HA binding to CD44 receptors and inhibit T cell proliferation.) .

HY-P4933

Tau Peptide (255-314) (Repeat 2 Domain) (human) Tau-F protein (255-314)	Tau Protein	Neurological Disease
Tau Peptide (255-314) (Repeat 2 Domain) (human) (Tau-F protein (255-314)) is a polypeptide. Tau Peptide (255-314) (human) is the 255-314 fragment of Tau-F (also known as Tau-4, the 2N4 isoform), a major isoform of the Tau protein. Tau Peptide (255-314) (human) contains two core driving sequences for Tau aggregation, namely PHF6* (275-280, VQIINK) and PHF6 (306-311, VQIVYK), and spans the C-terminal half of repeat domain R1, the entire repeat domain R2, and the N-terminal half of repeat domain R3 within the microtubule-binding region (MTBR).

HY-P11345

VPS35 c-terminal peptide	Biochemical Assay Reagents	Others
VPS35 c-terminal peptide is a peptide that can bind to VPS35. VPS35 c-terminal peptide can be used in immunoprecipitation experiments to specifically elute VPS35 and its interacting proteins, facilitating the identification of VPS35-interacting molecules .

HY-P10247

Amyloid precursor C-terminal peptide	Mitochondrial Metabolism	Neurological Disease
Amyloid precursor C-terminal peptide is cleaved from the C-terminus of Amyloid Precursor Protein (APP). Amyloid precursor C-terminal peptide accumulation causes mitochondrial morphology alteration and basal mitophagy failure, which indicates that amyloid precursor protein C-terminal peptide may correspond to an etiological trigger of Alzheimer’s disease (AD) pathology .

HY-P1841

Glucagon-Like Peptide (GLP) II, human	Endogenous Metabolite Apoptosis	Metabolic Disease
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .

HY-P3901

[Leu8,D-Trp22,Tyr25] Somatostatin-28	Somatostatin Receptor	Neurological Disease
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion .

HY-P11286

A7RC	Complement System	Cancer
A7RC is a multifunctional peptide used in tumor-targeted therapy, with Cysteine added to the C-terminal of the A7R peptide (sequence: ATWLPPR). A7R (HY-P1663) is a ligand of the NRP-1 receptor, regulating intracellular signal transduction related to tumor vascularization and tumor growth .

HY-P5182A

HsTX1 TFA	Potassium Channel	Inflammation/Immunology
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC₅₀ for Kv1.3 of 12 pM and inhibits T_EM cell activation and attenuates inflammation in autoimmunity .

HY-P10612A

Tetanus toxin (1301-1315) (C. tetani)	Bacterial	Infection Inflammation/Immunology
Tetanus toxin (1301-1315) (C. tetani) is a C-terminal peptide fragment of tetanus toxin heavy chain from C. tetani. Tetanus toxin (1301-1315) (C. tetani) can be used for the researches of infection and immunology .

HY-P5497

C34 peptide	HIV	Others
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)

HY-P1257

Xenin-8	Insulin Receptor Neurotensin Receptor	Metabolic Disease
Xenin-8, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC₅₀=0.16 nM) .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P5923

E70K	CXCR	Inflammation/Immunology
E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .

HY-P3418A

CKLF1-C27 TFA	CCR ERK	Inflammation/Immunology
CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .

HY-P11185

Hsp90β decapeptide	HSP	Cancer
Hsp90β decapeptide is a C-terminal peptide of Hsp90β, which contains conserved TPR-domain MEEVD. Hsp90β decapeptide is able to bind tightly the Tah1 protein with a K_d of 1.0 μM .

HY-P5323

Dabcyl-AGHDAHASET-Edans	Bacterial	Others
Dabcyl-AGHDAHASET-Edans is a biological active peptide. (This is a type I signal peptidase (SPase1) substrate peptide labeled with EDANS/ DABCYL FRET pair, and contains a crucial cleavage site derived from the C-terminal region of the Staphylococcus epidermidis pre-SceD protein. Abs/Em = 340/490 nm.)

HY-P1191

JIP-1(153-163) TI-JIP; JIP-1 peptide; JIPtide	JNK	Others
JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .

HY-P1191A

JIP-1(153-163) TFA TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA	JNK	Others
JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .

HY-P5370

Scrambled β-amyloid (1-40)	Amyloid-β	Others
Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)

HY-P5182

HsTX1	Potassium Channel	Inflammation/Immunology
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC₅₀ for Kv1.3 of 12 pM inhibits T_EM cell activation and attenuates inflammation in autoimmunity .

HY-P1257A

Xenin-8 TFA	Neurotensin Receptor	Metabolic Disease
Xenin-8 TFA, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 TFA stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC₅₀=0.16 nM) .

HY-162832

Amyloid-β-IN-1	Amyloid-β	Neurological Disease
Amyloid-β-IN-1 (compound 13) is a synthetic peptide containing the hydrophobic C-terminal region "VVIA-NH2" and its reverse sequence "AIVV-NH2" of Aβ₄₂, which is an Aβ inhibitor. Amyloid-β-IN-1 can inhibit Aβ aggregation and has neuroprotective effects .

HY-P5461

CHRG01	Bacterial	Others
CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)

HY-P5771

Jingzhaotoxin-IX	Sodium Channel	Neurological Disease
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .

HY-P10251

HIV gp120 (318-327)	HIV	Infection
HIV gp120 (318-327) is a short sequence of the HIV-1 strain IIIB envelope peptide (rgpgrafvti) that corresponds to the conserved C-terminal region of the glycoprotein. HIV gp120 (318-327) is part of the HIV vaccine V3 peptide epitope, also known as the I10 peptide. However, HIV gp120 (318-327) lacks the A2 anchor residues recognized by epitope-specific CTLs but has structural features that confer promiscuous A2 binding .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P5693

HBA(111–142)	Bacterial CMV HSV	Infection
HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .

HY-118161

1-Adamantylaspartate beta-1-Adamantylaspartic acid	Biochemical Assay Reagents	Others
1-Adamantylaspartate is a newly developed β-β-1-imidopropionic acid used to synthesize the C-terminal octapeptide of the β subunit of human chorionic gonadotropin (hCG) and the hexadecapeptide of the α subunit of the insulin receptor (30-55) by conventional solution methods and solid phase methods, aiming to inhibit the formation of asparagine during the synthesis of asparagyl peptides. Studies have shown that β-β-1-imidopropionic acid is an effective protector of the β-carboxyl function of aspartic acid residues.

HY-P1210

Lys-γ3-MSH(human)	Melanocortin Receptor	Endocrinology
Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC₅₀ of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .

HY-P1210A

Lys-γ3-MSH(human) TFA	Melanocortin Receptor	Endocrinology
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC₅₀ of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .

Cat. No.	Product Name	Target	Research Area