TLQP-62 (mouse,rat)
TLQP-62 (mouse,rat) is a secreted C-terminal peptide that can be derived from protein VGF. TLQP-62 activates the BDNF-TrkB signaling pathway, inducing acute, transient phosphorylation of TrkB receptor and downstream CREB (Ser133) phosphorylation. TLQP-62 demonstrates excellent efficacy in promoting long-term fear memory formationin wild-type mice and reversing memory impairment in VGF heterozygous knock-out mice. TLQP-62 can be used for the study of memory-related neurological disorders (e.g., Alzheimer’s disease, frontotemporal dementia).
For research use only. We do not sell to patients.
- Formula: C318H499N109O97
- Molecular Weight:7401.04
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
All Endogenous Metabolite Isoforms
More
Biological Activity
TLQP-62 (10 μM, 10 min) acutely and transiently activates TrkB receptor phosphorylation[1].
TLQP-62 (10 μM, 30 min) induces CREB phosphorylation (Ser133) and promotes cofilin phosphorylation in mouse hippocampal slices[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
TLQP-62 (5 mg/kg, i.p., once immediately after CFC training) reverses memory impairment in male N2F1 VGF heterozygous knock-out mice[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male C57BL/6J mice (2-3 months old)[1]
-
Dosage:0.3 μg/side
-
Administration:Bilateral hippocampal injection once immediately after training
-
Result:Achieved enhanced long-term fear memory formation.
Showed significant induction of CREB phosphorylation (Ser133) in the dorsal hippocampus, with a magnitude and kinetics similar to recombinant BDNF-induced CREB phosphorylation.
Appeared no significant effects on short-term memory or locomotor activity.
-
Animal Model:VGF germline heterozygous knock-out mouse[1]
-
Dosage:5 mg/kg
-
Administration:i.p. once immediately after CFC training
-
Result:Achieved reversed memory impairment in VGF heterozygous knock-out mice.
Restored Rac1 mRNA induction in the dorsal hippocampus.
Showed no enhancement of memory performance.
Chemical Information
-
Molecular Weight 7401.04
-
Formula C318H499N109O97
-
Sequence
Thr-Leu-Gln-Pro-Pro-Ala-Ser-Ser-Arg-Arg-Arg-His-Phe-His-His-Ala-Leu-Pro-Pro-Ala-Arg-His-His-Pro-Asp-Leu-Glu-Ala-Gln-Ala-Arg-Arg-Ala-Gln-Glu-Glu-Ala-Asp-Ala-Glu-Glu-Arg-Arg-Leu-Gln-Glu-Gln-Glu-Glu-Leu-Glu-Asn-Tyr-Ile-Glu-His-Val-Leu-Leu-His-Arg-Pro
-
Sequence Shortening
TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
TLQP-62 (mouse,rat) Related Classifications
HY-P11092 Related Classifications
Powered by Bioz