Defensin HNP-1 human

Name: Defensin HNP-1 human
Brand: MedChemExpress
SKU: HY-P2310
Rating: 4.5 (0 reviews)

Cat. No.: HY-P2310 Pureté: 98.12%: Fiche technique
COA

SDS
Instruction de manipulation
FAQs
Technical Support

Defensin HNP-1 human is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human has antileishmanial activity. Defensin HNP-1 human is involved in endothelial cell dysfunction during the early development of atherosclerosis.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

Defensin HNP-1 human Chemical Structure

CAS No. : 148093-65-6

Size	Stock	Quantité
100 μg	En stock	Estimated Time of Arrival: December 31
500 μg	En stock	Estimated Time of Arrival: December 31
1 mg	En stock	Estimated Time of Arrival: December 31
5 mg	Obtenir un devis
10 mg	Obtenir un devis

or Bulk Inquiry

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 1 Customer Validation

Other Forms of Defensin HNP-1 human:

Defensin HNP-1 human TFA In-stock

Recommandations en vedette

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Voir tous les produits spécifiques à Isoform Parasite:

Voir toutes les isoformes

Amebae Coccidia Leishmania Mite Plasmodium Toxoplasma Trypanosoma Schistosome

Voir tous les produits spécifiques à Isoform HIV:

Voir toutes les isoformes

HIV HIV-1 HIV-2

Voir tous les produits spécifiques à Isoform HSV:

Voir toutes les isoformes

HSV-1 HSV-2 HSV

Voir tous les produits spécifiques à Isoform TNF Receptor:

Voir toutes les isoformes

TNFRSF1A/CD120a TNFRSF3/CD18 TNFRSF4 TNFRSF5/CD40 TNFRSF6/Fas/CD95 TNFRSF7/CD27 TNFRSF8/CD30 TNFRSF9/4-1BB/CD137 TNFRSF10B/DR5/CD262 TNFRSF12A/TWEAK TNFRSF16/NGF Receptor/CD271 TNFRSF18/GITR/CD357

Voir tous les produits spécifiques à Isoform NOD-like Receptor (NLR):

Voir toutes les isoformes

NLRP3 NLRP1 NOD1 NOD2

Voir tous les produits spécifiques à Isoform DNA/RNA Synthesis:

Voir toutes les isoformes

RNASE L DNA Polymerases RNA Polymerases Helicases DNA Ligase

Activité biologique
Pureté et documentation
Références
Avis client

Description

IC₅₀ & Target^[1]^[3]

Leishmania

HSV-1

HSV-2

NLRP3 inflammasome

In Vitro

Defensin HNP-1 human (0-60 μg/mL, 16 h) exhibits concentration-dependent anti-leishmania protozoan activity, causing necrosis of the pre-flagellate bodies^[1].
Defensin HNP-1 human (0-60 μg/mL, 18-24 h) enhances the activity of neutrophils, delays the apoptosis of neutrophils that have not been infected with Leishmania major, and has no effect on the apoptosis of neutrophils that are already infected^[1].
Defensin HNP-1 human (20 μg/mL, 18 h) induces neutrophils to produce TNF-α and IL-8, reduces the TGF-β level in the infected group, and significantly decreases the survival rate of parasites in neutrophils^[1].
Defensin HNP-1 human upregulates the production of TNF-α and IL-1β in Staphylococcus aureus or monocytes at low concentrations, downregulates the level of IL-10, activates the NLRP3 inflammasome in macrophages induced by LPS (HY-D1056), and promotes the release of IL-1β^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Apoptosis Analysis^[1]

Cell Line:	Neutrophils with or without Leishmania major infection
Concentration:	20 μg/mL
Incubation Time:	18 h
Result:	Delayed the apoptosis of uninfected neutrophils and increases the proportion of living cells. Had no effect on the apoptosis of infected neutrophils.

ELISA Assay^[1]

Cell Line:	Neutrophils
Concentration:	20 μg/mL
Incubation Time:	18 h
Result:	Promoted the production of pro-inflammatory factor TNF-α and inhibited the immunosuppressive factor TGF-β.

In Vivo

Defensin HNP-1 human (10-30 μg/mouse, i.v., once every other day for 6 weeks) significantly reduces the plasma cholesterol levels in atherosclerotic mice, but promotes vascular lesions^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Atherogenesis model established in ApoE^-/- female mice^[2]
Dosage:	10 and 30 μg/mouse
Administration:	Intravenous injection (i.v.), once every other day for 6 weeks
Result:	Reduced plasma cholesterol, but also promoted the development of atherosclerotic lesions.

Masse moléculaire

3442.03

Formule

C₁₅₀H₂₂₂N₄₄O₃₈S₆

CAS No.

148093-65-6

Appearance

Solid

Color

White to off-white

Sequence

Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Sequence Shortening

ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvant et solubilité

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Pureté et documentation

Purity: 98.12%

Select Batch:

Fiche technique (266 KB) SDS (252 KB)

COA (250 KB) RP-HPLC (110 KB) MS (215 KB)

Instruction de manipulation (2659 KB)

Références

[1]. Dabirian S, et, al. Human neutrophil peptide-1 (HNP-1): a new anti-leishmanial drug candidate. PLoS Negl Trop Dis. 2013 Oct 17;7(10):e2491. [Content Brief]

[2]. Higazi M, et, al. Opposing effects of HNP1 (α-defensin-1) on plasma cholesterol and atherogenesis. PLoS One. 2020 Apr 17;15(4):e0231582. [Content Brief]

[3]. Zhang J, et al. HNP-1: From Structure to Application Thanks to Multifaceted Functions. Microorganisms. 2025 Feb 19;13(2):458. [Content Brief]