Defensin HNP-1 human TFA
Based on 1 Customer Validation
Defensin HNP-1 human TFA is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human TFA possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human TFA inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human TFA has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human TFA has antileishmanial activity. Defensin HNP-1 human TFA is involved in endothelial cell dysfunction during the early development of atherosclerosis.
For research use only. We do not sell to patients.
- Purity: 99.08%
- Formula: C160H227F15N44O48S6
- Molecular Weight:4012.15
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
|
Leishmania |
Defensin HNP-1 human (0-60 μg/mL, 16 h) TFA exhibits concentration-dependent anti-leishmania protozoan activity, causing necrosis of the pre-flagellate bodies[1].
Defensin HNP-1 human (0-60 μg/mL, 18-24 h) TFA enhances the activity of neutrophils, delays the apoptosis of neutrophils that have not been infected with Leishmania major, and has no effect on the apoptosis of neutrophils that are already infected[1].
Defensin HNP-1 human (20 μg/mL, 18 h) TFA induces neutrophils to produce TNF-α and IL-8, reduces the TGF-β level in the infected group, and significantly decreases the survival rate of parasites in neutrophils[1].
Defensin HNP-1 human TFA upregulates the production of TNF-α and IL-1β in Staphylococcus aureus or monocytes at low concentrations, downregulates the level of IL-10, activates the NLRP3 inflammasome in macrophages induced by LPS (HY-D1056), and promotes the release of IL-1β[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Neutrophils with or without Leishmania major infection
-
Concentration:20 μg/mL
-
Incubation Time:18 h
-
Result:Delayed the apoptosis of uninfected neutrophils and increases the proportion of living cells.
Had no effect on the apoptosis of infected neutrophils.
-
Cell Line:Neutrophils
-
Concentration:20 μg/mL
-
Incubation Time:18 h
-
Result:Promoted the production of pro-inflammatory factor TNF-α and inhibited the immunosuppressive factor TGF-β.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Atherogenesis model established in ApoE-/- female mice[2]
-
Dosage:10 and 30 μg/mouse
-
Administration:Intravenous injection (i.v.), once every other day for 6 weeks
-
Result:Reduced plasma cholesterol, but also promoted the development of atherosclerotic lesions.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4012.15
-
Formula C160H227F15N44O48S6
-
Color White to off-white
-
Sequence
Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)
-
Sequence Shortening
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
H2O : ≥ 50 mg/mL (12.46 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (281 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Dabirian S, et, al. Human neutrophil peptide-1 (HNP-1): a new anti-leishmanial drug candidate. PLoS Negl Trop Dis. 2013 Oct 17;7(10):e2491. [Content Brief]
[2]. Higazi M, et, al. Opposing effects of HNP1 (α-defensin-1) on plasma cholesterol and atherogenesis. PLoS One. 2020 Apr 17;15(4):e0231582. [Content Brief]
[3]. Zhang J, et al. HNP-1: From Structure to Application Thanks to Multifaceted Functions. Microorganisms. 2025 Feb 19;13(2):458. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2492 mL | 1.2462 mL | 2.4924 mL | 6.2311 mL |
| 5 mM | 0.0498 mL | 0.2492 mL | 0.4985 mL | 1.2462 mL | |
| 10 mM | 0.0249 mL | 0.1246 mL | 0.2492 mL | 0.6231 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Defensin HNP-1 human TFA Related Classifications
HY-P2310A Related Classifications
Powered by Bioz