Defensin HNP-1 human TFA 

Defensin HNP-1 human TFA is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human TFA possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human TFA inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human TFA has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human TFA has antileishmanial activity. Defensin HNP-1 human TFA is involved in endothelial cell dysfunction during the early development of atherosclerosis^[1][2][3].

Defensin HNP-1 human (0-60 μg/mL, 16 h) TFA exhibits concentration-dependent anti-leishmania protozoan activity, causing necrosis of the pre-flagellate bodies^[1].
Defensin HNP-1 human (0-60 μg/mL, 18-24 h) TFA enhances the activity of neutrophils, delays the apoptosis of neutrophils that have not been infected with Leishmania major, and has no effect on the apoptosis of neutrophils that are already infected^[1].
Defensin HNP-1 human (20 μg/mL, 18 h) TFA induces neutrophils to produce TNF-α and IL-8, reduces the TGF-β level in the infected group, and significantly decreases the survival rate of parasites in neutrophils^[1].
Defensin HNP-1 human TFA upregulates the production of TNF-α and IL-1β in Staphylococcus aureus or monocytes at low concentrations, downregulates the level of IL-10, activates the NLRP3 inflammasome in macrophages induced by LPS (HY-D1056), and promotes the release of IL-1β^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Defensin HNP-1 human (10-30 μg/mouse, i.v., once every other day for 6 weeks) TFA significantly reduces the plasma cholesterol levels in atherosclerotic mice, but promotes vascular lesions^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4012.15

C₁₆₀H₂₂₇F₁₅N₄₄O₄₈S₆

Solid

White to off-white

Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Dabirian S, et, al. Human neutrophil peptide-1 (HNP-1): a new anti-leishmanial drug candidate. PLoS Negl Trop Dis. 2013 Oct 17;7(10):e2491.  [Content Brief]

  [2]. Higazi M, et, al. Opposing effects of HNP1 (α-defensin-1) on plasma cholesterol and atherogenesis. PLoS One. 2020 Apr 17;15(4):e0231582.  [Content Brief]

  [3]. Zhang J, et al. HNP-1: From Structure to Application Thanks to Multifaceted Functions. Microorganisms. 2025 Feb 19;13(2):458.  [Content Brief]