1. Anti-infection Apoptosis Immunology/Inflammation Cell Cycle/DNA Damage
  2. Bacterial Parasite Apoptosis HIV HSV CMV TNF Receptor NOD-like Receptor (NLR) DNA/RNA Synthesis Influenza Virus
  3. Defensin HNP-1 human

Defensin HNP-1 human is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human has antileishmanial activity. Defensin HNP-1 human is involved in endothelial cell dysfunction during the early development of atherosclerosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Defensin HNP-1 human

Defensin HNP-1 human Chemical Structure

CAS No. : 148093-65-6

Size Price Stock Quantity
100 μg In-stock
500 μg In-stock
1 mg In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Other Forms of Defensin HNP-1 human:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Defensin HNP-1 human is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human has antileishmanial activity. Defensin HNP-1 human is involved in endothelial cell dysfunction during the early development of atherosclerosis[1][2][3].

IC50 & Target[1][3]

Leishmania

 

HSV-1

 

HSV-2

 

NLRP3 inflammasome

 

In Vitro

Defensin HNP-1 human (0-60 μg/mL, 16 h) exhibits concentration-dependent anti-leishmania protozoan activity, causing necrosis of the pre-flagellate bodies[1].
Defensin HNP-1 human (0-60 μg/mL, 18-24 h) enhances the activity of neutrophils, delays the apoptosis of neutrophils that have not been infected with Leishmania major, and has no effect on the apoptosis of neutrophils that are already infected[1].
Defensin HNP-1 human (20 μg/mL, 18 h) induces neutrophils to produce TNF-α and IL-8, reduces the TGF-β level in the infected group, and significantly decreases the survival rate of parasites in neutrophils[1].
Defensin HNP-1 human upregulates the production of TNF-α and IL-1β in Staphylococcus aureus or monocytes at low concentrations, downregulates the level of IL-10, activates the NLRP3 inflammasome in macrophages induced by LPS (HY-D1056), and promotes the release of IL-1β[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Apoptosis Analysis[1]

Cell Line: Neutrophils with or without Leishmania major infection
Concentration: 20 μg/mL
Incubation Time: 18 h
Result: Delayed the apoptosis of uninfected neutrophils and increases the proportion of living cells.
Had no effect on the apoptosis of infected neutrophils.

ELISA Assay[1]

Cell Line: Neutrophils
Concentration: 20 μg/mL
Incubation Time: 18 h
Result: Promoted the production of pro-inflammatory factor TNF-α and inhibited the immunosuppressive factor TGF-β.
In Vivo

Defensin HNP-1 human (10-30 μg/mouse, i.v., once every other day for 6 weeks) significantly reduces the plasma cholesterol levels in atherosclerotic mice, but promotes vascular lesions[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Atherogenesis model established in ApoE-/- female mice[2]
Dosage: 10 and 30 μg/mouse
Administration: Intravenous injection (i.v.), once every other day for 6 weeks
Result: Reduced plasma cholesterol, but also promoted the development of atherosclerotic lesions.
Molecular Weight

3442.03

Formula

C150H222N44O38S6

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Sequence Shortening

ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Defensin HNP-1 human
Cat. No.:
HY-P2310
Quantity:
MCE Japan Authorized Agent: