1. Metabolic Enzyme/Protease
  2. Endogenous Metabolite
  3. Defensin HNP-1 human

Defensin HNP-1 human 

Cat. No.: HY-P2310
Handling Instructions

Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Defensin HNP-1 human Chemical Structure

Defensin HNP-1 human Chemical Structure

CAS No. : 99287-08-8

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.

IC50 & Target

Human Endogenous Metabolite

 

Molecular Weight

3442.03

Formula

C₁₅₀H₂₂₈N₄₄O₃₈S₆

CAS No.

99287-08-8

Sequence

{Ala}{Cys}{Tyr}{Cys}{Arg}{Ile}{Pro}{Ala}{Cys}{Ile}{Ala}{Gly}{Glu}{Arg}{Arg}{Tyr}{Gly}{Thr}{Cys}{Ile}{Tyr}{Gln}Gly}{Arg}{Leu}{Trp}{Ala}{Phe}{Cys}{Cys}

Sequence Shortening

ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Defensin HNP-1 humanEndogenous MetaboliteInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Defensin HNP-1 human
Cat. No.:
HY-P2310
Quantity:
MCE Japan Authorized Agent: