1. GPCR/G Protein PI3K/Akt/mTOR MAPK/ERK Pathway Apoptosis NF-κB Metabolic Enzyme/Protease Immunology/Inflammation
  2. GLP Receptor Akt MEK Apoptosis Reactive Oxygen Species (ROS) MMP
  3. Lixisenatide

Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis, diabetes, Alzheimer's disease and atherosclerosis.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

Lixisenatide

Lixisenatide Estructura química

No. CAS : 320367-13-3

Tamaño Precio Stock Cantidad
1 mg En stock
5 mg En stock
10 mg En stock
25 mg En stock
50 mg En stock
100 mg En stock
200 mg   Obtener un presupuesto  
500 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Revisión del cliente

Based on 2 publication(s) in Google Scholar

Other Forms of Lixisenatide:

Top Publications Citing Use of Products

Ver todos los productos específicos de isoformas Akt:

Ver todos los productos específicos de isoformas MEK:

Ver todos los productos específicos de isoformas MMP:

  • Actividad biológica

  • Pureza y Documentación

  • Referencias

  • Revisión del cliente

Descripciòn

Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis, diabetes, Alzheimer's disease and atherosclerosis[1][2][3][4][5][6].

IC50 & Target[1]

GLP-1

 

MEK1

 

MEK2

 

MMP-1

 

MMP-3

 

MMP13

 

In Vitro

Lixisenatide (100 μM, 24 h) inhibits the Aβ25-35 (HY-P0128)-induced cytotoxicity on cultured hippocampal cells. [1].
Lixisenatide (100 μM, 24 h) relieves the Aβ25-35-induced suppression of the Akt-MEK1/2 signaling pathway on cultured hippocampal cells [1].
Lixisenatide (10-20 μM, 48 h) ameliorates IL-1β-induced oxidative stress, mitochondrial dysfunction, and apoptosis in fibroblast-like synoviocytes (FLSs) [3].
Lixisenatide (10-20 μM, 48 h) reduces IL-1β-induced expression of MMPs and inhibits activation of proinflammatory pathways by IL-1β in FLSs[3].
Lixisenatide (10-20 μM, 6 h) reduced oxygen-glucose deprivation/reperfusion (OGD/R)-induced generation of ROS in HUVECs[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[1]

Cell Line: Fibroblast-like synoviocytes
Concentration: 10 and 20 μM
Incubation Time: 48 h
Result: Significantly reduced expression of MMP-1, MMP-3, and MMP-13 at both the mRNA and protein levels in a dose-dependent manner.
In Vivo

Lixisenatide (10 μg/kg, Subcutaneous injection, once a day for a month) diminishes the atherosclerosis burden and systemic inflammation in Apoe−/− Irs2+/− mice[2].
Lixisenatide (1 nmol/kg, Intraperitoneal injection, once a day for 14 days) shows renoprotective effects on experimental early diabetic nephropathy in diabetic rats [4].
Lixisenatide (1-10 mg/kg, i.p., daily for 10 weeks) improves cognitive ability in APP/PS1 mice[6].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Apoe−/− Irs2+/− mice models[2]
Dosage: 10 μg/kg
Administration: Subcutaneously injection, daily for a month
Result: Exhibited smaller atheromas in the aortic arch region.
Reduced the lesion size in cross-sections of hearts.
Animal Model: Diabetic rats[4]
Dosage: 1 nmol/kg
Administration: Intraperitoneally injection, once a day for a month
Result: Showed a significant amelioration on the elevated renal parameters.
Showed significant mitigation in renal MDA and total NOx (by 50.3 and 79.9%, respectively) and 43.9% elevation in renal total antioxidant capacity.
Averted the observed increments in iNOS and COX-2 expressions in the renal tissues of the diabetic group.
Decreased the level of TGF-β protein expression.
Animal Model: APP/PS1 mice[6]
Dosage: 1 and 10 mg/kg
Administration: Intraperitoneally injection, daily for 10 weeks
Result: Improved cognitive ability.
Prevented the reduction of synapse numbers.
Reduced amyloid plaque load and chronic inflammation response (microglial activation).
Ensayo clínico
Peso molecular

4858.49

Fòrmula

C215H347N61O65S

No. CAS
Appearance

Solid

Color

White to pink

Sequence

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2

Sequence Shortening

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvente y solubilidad
In Vitro: 

H2O : 100 mg/mL (20.58 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2058 mL 1.0291 mL 2.0583 mL
5 mM 0.0412 mL 0.2058 mL 0.4117 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Calculadora de molaridad

  • Calculadora de dilución

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureza y Documentación

Purity: 99.93%

Referencias

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2058 mL 1.0291 mL 2.0583 mL 5.1456 mL
5 mM 0.0412 mL 0.2058 mL 0.4117 mL 1.0291 mL
10 mM 0.0206 mL 0.1029 mL 0.2058 mL 0.5146 mL
15 mM 0.0137 mL 0.0686 mL 0.1372 mL 0.3430 mL
20 mM 0.0103 mL 0.0515 mL 0.1029 mL 0.2573 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Nombre del producto

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Lixisenatide
Cat. No.:
HY-P0119
Cantidad:
MCE Japan Authorized Agent: