Search Result
Results for "
TAT peptide
" in MedChemExpress (MCE) Product Catalog:
4
Biochemical Assay Reagents
1
Isotope-Labeled Compounds
| Cat. No. |
상품명 |
Target |
연구분야 |
Chemical Structure |
-
- HY-P0281
-
|
TAT(47-57); HIV-1 TAT protein (47-57)
|
HIV
|
Infection
|
|
TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
-
- HY-P4108
-
|
|
Influenza Virus
|
Infection
|
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
-
-
- HY-P0282A
-
|
|
HIV
|
Infection
|
|
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
-
- HY-P2260
-
Tat-beclin 1
Maximum Cited Publications
6 Publications Verification
|
CHIKV
Autophagy
HIV
|
Infection
|
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
-
-
- HY-P1136B
-
-
-
- HY-P5307
-
|
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy .
|
-
-
- HY-P10275
-
|
|
Apoptosis
|
Neurological Disease
|
|
Tat-NTS peptide is a cell-penetrating peptide with neuroprotective effects. Tat-NTS peptide can specifically inhibit the nuclear translocation of ANXA1 and reduce neuronal apoptosis in ischemic areas. Moreover, Tat-NTS peptide can reduce the volume of cerebral ischemic infarction and can be used in the research of ischemic stroke .
|
-
-
- HY-172279A
-
|
|
Liposome
|
Cancer
|
|
DSPE-PEG2000-TAT is a cell-penetrating peptide-modified PEGylated phospholipid conjugate and cellular uptake enhancer. DSPE-PEG2000-TAT forms via conjugation of Cys-TAT to DSPE-PEG2000-Mal. DSPE-PEG2000-TAT enhances liposomal cellular uptake and siRNA transfection efficiency in glomerular mesangial and macrophage cells. DSPE-PEG2000-TAT can be used for drug delivery .
|
-
-
- HY-P0282
-
|
|
HIV
|
Infection
|
|
TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
-
- HY-P11117
-
|
|
TRP Channel
iGluR
Calcium Channel
|
Neurological Disease
|
|
TAT-EE3 is a neuroprotective peptide which can uncouple TRPM2-NMDARs interaction. TAT-EE3 inhibits TRPM2-induced enhancement of NMDAR surface expression and current amplitude.TAT-EE3 protects neurons against ischemic injury in vitro and in vivo. TAT-EE3can be used for the study of ischemic stroke .
|
-
-
- HY-P5381
-
-
-
- HY-P2280
-
-
-
- HY-P1491
-
|
|
HIV
|
Infection
|
|
HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
|
-
-
- HY-P1420
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
-
- HY-P2259
-
|
|
iGluR
HIV Integrase
Adenosine Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
TAT-GluA2 3Y is a blood-brain barrier-permeable AMPA receptor inhibitory peptide that crosses cell membranes via the HIV-1 TAT protein domain. TAT-GluA2 3Y blocks the endocytosis of AMPA receptors, including the internalization of GluA1/GluA2 subunits, by disrupting interactions with the AP2, Brag2 and Syt3-GluA2 complexes, while also inhibiting long-term depression. TAT-GluA2 3Y blocks hypoxia-mediated AMPAR internalization, alleviates A1R-induced persistent synaptic inhibition, and reduces cerebral ischemic volume, neurological deficits and spatial memory deficits. TAT-GluA2 3Y blocks the effect of NLRP3 deficiency on fear generalization, inhibits amphetamine-induced behavioral/neurochemical sensitization, weakens the unconditioned stimulus-conditioned stimulus association of morphine, and promotes the extinction of morphine CPP. TAT-GluA2 3Y can be used in studies related to fear generalization, ischemic stroke, hypoxia, drug addiction and opioid addiction .
|
-
-
- HY-P0281A
-
|
TAT(47-57) TFA; HIV-1 TAT protein (47-57) TFA
|
HIV
|
Infection
|
|
TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
-
- HY-P4125A
-
|
|
HIV
Fluorescent Dye
|
Others
|
|
FITC-LC-TAT (47-57) acetate is a FITC-labeled TAT peptide (HY-P0281) (λex: 493 nm, λem: 522 nm). Derived from the trans-activator of transcription (TAT) of immunodeficiency virus (HIV-1), TAT enhances the yield of heterologous proteins .
|
-
-
- HY-P4122A
-
|
|
HIV
|
Others
|
|
TAT (47-57), FAM-labeled acetate is a 5(6)-Carboxyfluorescein (HY-15940)-labeled TAT (HY-P0281). TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide .
|
-
-
- HY-P4122
-
|
|
HIV
|
Others
|
|
TAT (47-57), FAM-labeled is a 5(6)-Carboxyfluorescein (HY-15940)-labeled TAT (HY-P0281). TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide .
|
-
-
- HY-P1328
-
TAT-14
1 Publications Verification
|
Keap1-Nrf2
|
Others
|
|
TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
-
- HY-P10446
-
|
|
Epigenetic Reader Domain
PROTACs
|
Cancer
|
|
TAT-PiET-PROTAC is a proteolysis-targeting chimera (PROTAC)-modified TAT-PiET (HY-P10445), which is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET-PROTAC can reduce BRD4 and JMJD6 levels and inhibit cell proliferation. TAT-PiET-PROTAC also resists the endocrine resistance of ERα-positive breast cancer cells. TAT-PiET-PROTAC can be used for the research of cancer, such as breast cancer .
|
-
-
- HY-P3432
-
|
|
Biochemical Assay Reagents
|
Others
|
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
-
-
- HY-P1801A
-
|
Cys-[HIV-TAT (47-57)] TFA
|
HIV
Drug Derivative
|
Others
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) TFA, TAT (HY-P0281) derivative, is a Cysteine (HY-Y0337)-tagged cell-penetrating peptide (CPP) derived from the HIV TAT protein. Cys-TAT(47-57) TFA can be used for the research for the research of drug delivery .
|
-
-
- HY-P4123
-
|
|
MMP
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
TAT (47-57) GGG-Cys (Npys) is a cell-penetrating peptide and delivery carrier derived from TAT. TAT (47-57) GGG-Cys (Npys) facilitates the translocation of conjugated drug molecules across cell membranes. TAT (47-57) GGG-Cys (Npys) acts as a delivery carrier for MT1-MMP inhibitors. TAT (47-57) GGG-Cys (Npys) is applicable to research on diseases associated with MT1-MMP activity, such as cancer, arthritis, heart disease, and vascular disorders .
|
-
-
- HY-P10438
-
|
|
Raf
|
Cancer
|
|
TAT-Braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by TAT-Braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
|
-
-
- HY-P4056A
-
|
P15-TAT aceTATe
|
Casein Kinase
Apoptosis
|
Cancer
|
|
CIGB-300 acetate (P15-Tat acetate) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 acetate induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
-
- HY-D2441
-
|
|
Fluorescent Dye
|
Cancer
|
|
TAT-PEG-Cy3 is a fluorescent labeling reagent that combines Cy3 fluorescent dye, Cell membrane penetrating peptide (TAT) and polyethylene glycol (PEG). The Cy3 fluorophore is commonly used in applications such as immunolabeling, nucleic acid labeling, fluorescence microscopy, and flow cytometry. Cy3 has an emission maximum around 562-570 nm. TAT-PEG-Cy3 can be used for cell targeted delivery and biological imaging .
|
-
-
- HY-P2500
-
|
|
Fluorescent Dye
|
Others
|
|
(Arg)9, FAM-labeled, a cell-penetrating peptide (CPP), is a nona-arginine (ARG) with FAM label. CPPs have emerged as powerful tools for delivering bioactive cargoes into the cytosol of intact cells .
|
-
-
- HY-P4125
-
|
|
HIV
Fluorescent Dye
|
Infection
|
|
FITC-LC-TAT (47-57) is a FITC-labeled TAT peptide (HY-P0281) (λex: 493 nm, λem: 522 nm). Derived from the trans-activator of transcription (TAT) of human immunodeficiency virus (HIV-1), TAT enhances the yield of heterologous proteins .
|
-
-
- HY-172279
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG1000-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG1000-TAT can be used for drug delivery .
|
-
-
- HY-172279C
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG3400-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG3400-TAT can be used for drug delivery .
|
-
-
- HY-P1136C
-
-
-
- HY-P4056
-
|
P15-TAT
|
Casein Kinase
Apoptosis
|
Cancer
|
|
CIGB-300 (P15-Tat) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
-
- HY-P3730
-
|
|
CDK
|
Cancer
|
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
-
-
- HY-P10839
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
NBD peptide inhibits NF-κB signaling pathway through inhibition of the NEMO-IKK complex combination. NBD peptide exhibits anti-inflammatory efficacy through block of pro-inflammatory cytokines production. NBD peptide exhibits immunosuppressive activity through regulation of immune cells. NBD peptide enhances its transmembrane ability by combining with cell-penetrating peptide HIV-TAT .
|
-
-
- HY-P10405A
-
|
|
Dopamine Receptor
|
Neurological Disease
|
|
TAT-D1 peptide acetate is a dopamine D1-D2 receptor heterodimer inhibitor. TAT-D1 peptide acetate disrupts the function of dopamine D1-D2 receptor heteromers, enhances subchronic amphetamine-induced locomotor activity, and exacerbates the expression of amphetamine-induced locomotor sensitization. TAT-D1 peptide acetate produces rapid anxiolytic and antidepressant-like effects in rat models of depression and anxiety, and inhibits c-fos expression in the nucleus accumbens of rats. TAT-D1 peptide acetate can be used in the research of psychostimulant addiction, depression and anxiety disorders .
|
-
-
- HY-P10359A
-
|
|
TGF-beta/Smad
MMP
|
Neurological Disease
|
|
TAT-QFNP12 acetate is a peptide that blocks the NDRG2-PPM1A binding and reduces Smad2/3 phosphorylation, decreases astrocytic MMP-9 production and BBB disruption after subarachnoid hemorrhage (SAH) .
|
-
-
- HY-P4101
-
|
|
HIV
|
Infection
|
|
Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1 .
|
-
-
- HY-P1801
-
|
Cys-[HIV-TAT (47-57)]
|
HIV
Drug Derivative
|
Others
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]), TAT (HY-P0281) derivative, is a Cysteine (HY-Y0337)-tagged cell-penetrating peptide (CPP) derived from the HIV TAT protein. Cys-TAT(47-57) can be used for the research for the research of drug delivery .
|
-
-
- HY-P10966A
-
|
|
IKK
NF-κB
|
Inflammation/Immunology
|
|
Tat-IKIP (46-60) TFA is the trifluoroacetic acid of Tat-IKIP (46-60) (HY-P10966). Tat-IKIP (46-60) is a IκB kinase (IKK)-targeting membrane-penetrating peptide. Tat-IKIP (46-60) inhibits IKK activation and NF-κB targeted gene expression by disrupting the IKKβ/NEMO complex. Tat-IKIP (46-60) significantly reduces DSS (HY-116282)-induced acute inflammation in inflammatory bowel disease (IBD) mice model and attenuates Zymosan-induced acute arthritis in acute arthritis model (AAM). Tat-IKIP (46-60) can be used for inflammatory diseases research, such as IBD, pancreatitis and rheumatoid arthritis .
|
-
-
- HY-P1575
-
|
|
HIV
|
Infection
|
|
TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
-
- HY-P4114
-
|
|
HIV
|
Others
|
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
-
-
- HY-P11219
-
|
|
YAP
|
Cancer
|
|
TAT-PDHPS1 is a YAP inhibitor composed of the endogenous peptide PDHPS1 and the cell-penetrating peptide sequence TAT. PDHPS1 binds to protein phosphatase 2 phosphatase activator (PTPA), an essential activator of protein phosphatase 2A (PP2A), leading to increased YAP phosphorylation, which inactivates YAP and suppresses the expression of its downstream target genes. TAT-PDHPS1 is potentially useful in ovarian cancer research .
|
-
-
- HY-P10638A
-
|
|
CaMK
|
Cardiovascular Disease
Neurological Disease
|
|
TAT-CN21 (scrambled) is a nonsense sequence control peptide fused with the TAT cell-penetrating sequence. It exerts no inhibitory effect on CaMKII activity and serves as a negative control for TatCN21 (HY-P10638) .
|
-
-
- HY-P10360
-
|
|
α-synuclein
|
Neurological Disease
|
|
Tat-βsyn-degron is an α-synuclein knockdown peptide that effectively degrades α-synuclein protein via the proteasome pathway. Tat-βsyn-degron effectively reduces α-synuclein protein levels in primary rat cortical neuron cultures. In a Parkinson's mouse toxicity model, Tat-βsyn-degron can alleviate parkinsonian toxin-induced neuronal damage and movement disorders .
|
-
-
- HY-P10358
-
|
|
Calcium Channel
|
Neurological Disease
|
|
TAT-CBD3A6K, is a modified TAT-CBD3 peptide. TAT-CBD3A6K reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function .
|
-
-
- HY-P3429
-
|
|
PKC
|
Cardiovascular Disease
|
|
SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
-
- HY-P4110
-
|
|
iGluR
|
Metabolic Disease
Inflammation/Immunology
|
|
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor .
|
-
-
- HY-P10405
-
|
|
Dopamine Receptor
|
Neurological Disease
|
|
TAT-D1 peptide is a dopamine D1-D2 receptor heterodimer inhibitor. TAT-D1 peptide disrupts the function of dopamine D1-D2 receptor heteromers, enhances subchronic amphetamine-induced locomotor activity, and exacerbates the expression of amphetamine-induced locomotor sensitization. TAT-D1 peptide produces rapid anxiolytic and antidepressant-like effects in rat models of depression and anxiety, and inhibits c-fos expression in the nucleus accumbens of rats. TAT-D1 peptide can be used in the research of psychostimulant addiction, depression and anxiety disorders .
|
-
-
- HY-P5307A
-
|
INF7-A5K-TAT aceTATe
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) acetate is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K acetate can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K acetate enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy .
|
-
- HY-P5320
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P11000
-
|
|
Biochemical Assay Reagents
|
Others
|
|
INF7TAT is an amphipathic peptide containing the influenza HA2 sequence and the TAT peptide (HY-P0281). INF7TAT can associate with other macromolecules through non-covalent associations. INF7TAT can be used for non-toxic delivery of siRNAs .
|
-
- HY-P0281B
-
|
TAT(47-57) aceTATe; HIV-1 TAT protein (47-57) aceTATe
|
HIV
|
Infection
|
|
TAT (TAT(47-57)) acetate is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT acetate can increase the yields and the solubility of heterologous proteins .
|
-
- HY-172279B
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG5000-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG5000-TAT can be used for drug delivery .
|
-
- HY-P1575A
-
|
|
HIV
|
Infection
|
|
TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57 .
|
-
- HY-P11222
-
-
- HY-P4105
-
-
- HY-P5754
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
-
- HY-P10357
-
|
|
HIV
iGluR
|
Infection
Inflammation/Immunology
|
|
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .
|
-
- HY-P1420A
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P10106
-
|
|
PAK
|
Cancer
|
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
-
- HY-P2260A
-
|
|
Autophagy
HIV
|
Infection
|
|
Tat-beclin 1 TFA, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 TFA decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
-
- HY-P1908
-
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
- HY-P10797
-
-
- HY-P5320A
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P10966
-
|
|
IKK
NF-κB
|
Inflammation/Immunology
|
|
Tat-IKIP (46-60) is a IκB kinase (IKK)-targeting membrane-penetrating peptide. Tat-IKIP (46-60) inhibits IKK activation and NF-κB targeted gene expression by disrupting the IKKβ/NEMO complex. Tat-IKIP (46-60) significantly reduces DSS (HY-116282)-induced acute inflammation in inflammatory bowel disease (IBD) mice model and attenuates Zymosan-induced acute arthritis in acute arthritis model (AAM). Tat-IKIP (46-60) can be used for inflammatory diseases research, such as IBD, pancreatitis and rheumatoid arthritis .
|
-
- HY-P5384
-
|
|
NADPH Oxidase
|
Others
|
|
sgp91 ds-tat is a biological active peptide. (This is a scrambled control peptide for gp91 ds-tat.)
|
-
- HY-P10465
-
|
|
TRP Channel
|
Inflammation/Immunology
|
|
TRPV1-Tat is an antagonistic peptide that fuses the TRPV1 (transient receptor potential vanilla subtype 1) of the cell-penetrating peptide Tat. TRPV1-Tat blocks this phosphorylation process by competitively binding to the AKAP79 binding site of TRPV1, thereby inhibiting the sensitization of TRPV1. TRPV1-Tat can be used in the study of inflammatory pain .
|
-
- HY-P5891
-
|
|
PKC
|
Cardiovascular Disease
|
|
TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
|
-
- HY-P10074
-
|
|
ERK
|
Inflammation/Immunology
|
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
-
- HY-P5117
-
|
|
Toll-like Receptor (TLR)
|
Neurological Disease
|
|
TAT-CIRP is a a small peptide, refers to Trans-trans-activating (Tat)-cold-inducible RNA binding protein. TAT-CIRP is an inhibitor of myeloid differentiation protein 2 (MD2). TAT-CIRP exhibits robust neuroprotection against ischemic and hemorrhagic stroke in mice .
|
-
- HY-P10076
-
|
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
-
- HY-P4106A
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P4106
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P10107
-
|
|
Ras
|
Others
|
|
TAT-PAK18 R192A is an inactive Tat-Pak peptide. TAT-PAK18 R192A does not have any effect in the translocation of Rac1 triggered by any of the interrogated proteins .
|
-
- HY-P10995
-
|
|
EGFR
IFNAR
Interleukin Related
TNF Receptor
Complement System
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
TAT-327 is cell-penetrating peptide. TAT-327 selectively inserts into cancer cell membranes and shows potent antitumor activity. TAT-327 effectively inhibits cancer cells proliferation, induces apoptosis and disrupts EGFR signal pathway by inhibiting downstream signals (such as IL-2, TNF-α and IFN-γ) expression and the Eps8/EGFR interaction. TAT-327 significantly inhibits tumor growth in HT-29 xenograft mcie models .
|
-
- HY-P1328A
-
|
|
Keap1-Nrf2
|
Others
|
|
TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
- HY-P10445
-
|
|
Epigenetic Reader Domain
|
Cancer
|
|
TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET can reduce BRD4 and JMJD6 levels and inhibit cell proliferation. TAT-PiET also resists the endocrine resistance of ERα-positive breast cancer cells. TAT-PiET can be used for the research of cancer, such as breast cancer .
|
-
- HY-P11152
-
|
|
HIV
|
Infection
Inflammation/Immunology
|
|
HIV-1 tat Protein (1-9) occurs extracellularly and has a role in the immunosuppression of non-HIV-1-infected T cells in acquired AIDS. HIV-1 tat Protein (1-9) is an inhibitor of DP IV. HIV-1 tat Protein (1-9) can be synthesized by phase peptide synthesis with Fmoc (N-(9-fluorenyl)methoxycarbonyl) technique using the peptide synthesizer 431A. HIV-1 tat Protein (1-9) can be studied in research on HIV-1 .
|
-
- HY-P10852
-
-
- HY-P5277
-
|
|
DAPK
|
Neurological Disease
|
|
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
|
-
- HY-P2307
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
-
- HY-P2307A
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
-
- HY-P10821
-
-
- HY-P5754A
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
-
- HY-P4103
-
-
- HY-P10358A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
TAT-CBD3A6K acetate, is a modified TAT-CBD3 peptide. TAT-CBD3A6K acetate reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K acetate shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function .
|
-
- HY-P10110
-
|
|
Autophagy
|
Neurological Disease
|
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
-
- HY-P2298
-
|
|
PKC
|
Neurological Disease
|
|
TAT-P4-(DATC5)2 is a high-affinity peptide inhibitor of the PICK1 (protein interacting with C kinase-1) PDZ domain, with a Ki of 1.7 nM. TAT-P4-(DATC5)2 can inhibit addiction in rats .
|
-
- HY-P2298A
-
|
|
PKC
|
Neurological Disease
|
|
TAT-P4-(DATC5)2 TFA is a high-affinity peptide inhibitor of the PICK1 (protein interacting with C kinase-1) PDZ domain, with a Ki of 1.7 nM. TAT-P4-(DATC5)2 TFA can inhibit addiction in rats .
|
-
- HY-P10464
-
|
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P3731
-
|
|
CDK
|
Cancer
|
|
Cdk2/Cyclin Inhibitory Peptide II (Tat-LDL), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
-
- HY-P10977
-
|
|
Sodium Channel
RIP kinase
|
Neurological Disease
|
|
Tat-ASIC1a (1-20) (mouse, rat) is a competitive ASIC1a membrane-penetrating peptide. Tat-ASIC1a (1-20) (mouse, rat) has significantly neuroprotection effects, and reduces neuronal damage against acidotoxicity by targeting the ASIC1a-RIPK1 pathway and auto-inhibitory mechanism. Tat-ASIC1a (1-20) (mouse, rat) effectively protects brains from ischemic injury in ischemic stroke mice model. Tat-ASIC1a (1-20) (mouse, rat) can be used for neurodegenerative diseases research, such as Huntington disease and Parkinson’s disease .
|
-
- HY-P0281F
-
|
Cy5-TAT(47-57) aceTATe; Cy5-HIV-1 TAT protein (47-57) aceTATe
|
Fluorescent Dye
|
Others
|
|
Cy5-TAT acetate is a TAT peptide labeled with CY5 (HY-D0821) (Ex= 600-620 nm, Em= 670 nm). Cy5-TAT acetate can be used for fluorescence microscopy especially single-molecule fluorescence imaging .
|
-
- HY-180187
-
|
|
HIV
|
Infection
|
|
019854-B06 is a potent inhibitor of Tat-mediated HIV-1 transcription (IC50 = 1.44 μM), exhibiting antiviral activity against HIV-1 (EC50 = 0.83 μM). 019854-B06 binds to Tat peptide (KD = 33.5 μM), but not to TAR RNA. 019854-B06 neither promotes Tat degradation nor disrupts the Tat/CycT1 complex, supporting a Tat-centric, nondegradative mechanism .
|
-
- HY-P10357A
-
|
|
HIV
iGluR
|
Infection
Inflammation/Immunology
|
|
Tat-CBD3 TFA, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .
|
-
- HY-P3730A
-
|
|
CDK
|
Cancer
|
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG) acetate, a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
-
- HY-P10359
-
|
|
TGF-beta/Smad
MMP
|
Neurological Disease
|
|
TAT-QFNP12 is a peptide that blocks the NDRG2-PPM1A binding and reduces Smad2/3 phosphorylation, decreases astrocytic MMP-9 production and BBB disruption after subarachnoid hemorrhage (SAH) .
|
-
- HY-P5107A
-
|
LMWP aceTATe; TDSP5 aceTATe
|
VEGFR
|
Cancer
|
|
Low molecular weight protamine acetate (LMWP acetate;TDSP5 acetate) is a truncated arginine-rich protamine peptide, which also acts as an antidote for heparin/low molecular weight heparin and a cell-penetrating delivery vector. Low molecular weight protamine acetate neutralizes heparin-induced anticoagulant activities, including aPTT, anti-Xa and anti-IIa activities. Low molecular weight protamine acetate translocates across mammalian cell membranes, delivers conjugated impermeable molecules through tumor tissues, enhances the skin permeability of conjugated epidermal growth factor, and accelerates wound healing when conjugated with epidermal growth factor. Low molecular weight protamine acetate retains the in vitro cell proliferation activity of conjugated EGF, and also enables site-specific conjugation with peptides or proteins via genetic recombination. Low molecular weight protamine acetate can be used in studies related to colon cancer, skin wounds and diabetic skin wounds .
|
-
-
- HY-D2441
-
|
|
Fluorescent Dyes
|
|
TAT-PEG-Cy3 is a fluorescent labeling reagent that combines Cy3 fluorescent dye, Cell membrane penetrating peptide (TAT) and polyethylene glycol (PEG). The Cy3 fluorophore is commonly used in applications such as immunolabeling, nucleic acid labeling, fluorescence microscopy, and flow cytometry. Cy3 has an emission maximum around 562-570 nm. TAT-PEG-Cy3 can be used for cell targeted delivery and biological imaging .
|
-
- HY-172279A
-
|
|
Biochemical Assay Reagents
|
|
DSPE-PEG2000-TAT is a cell-penetrating peptide-modified PEGylated phospholipid conjugate and cellular uptake enhancer. DSPE-PEG2000-TAT forms via conjugation of Cys-TAT to DSPE-PEG2000-Mal. DSPE-PEG2000-TAT enhances liposomal cellular uptake and siRNA transfection efficiency in glomerular mesangial and macrophage cells. DSPE-PEG2000-TAT can be used for drug delivery .
|
-
- HY-172279
-
|
|
Biochemical Assay Reagents
|
|
DSPE-PEG1000-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG1000-TAT can be used for drug delivery .
|
-
- HY-172279C
-
|
|
Biochemical Assay Reagents
|
|
DSPE-PEG3400-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG3400-TAT can be used for drug delivery .
|
-
- HY-172279B
-
|
|
Biochemical Assay Reagents
|
|
DSPE-PEG5000-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG5000-TAT can be used for drug delivery .
|
| Cat. No. |
상품명 |
Target |
Research Area |
-
- HY-P0281
-
|
TAT(47-57); HIV-1 TAT protein (47-57)
|
HIV
|
Infection
|
|
TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P4108
-
|
|
Influenza Virus
|
Infection
|
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
-
- HY-P0282A
-
|
|
HIV
|
Infection
|
|
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
- HY-P1136B
-
-
- HY-P5307
-
|
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy .
|
-
- HY-P10275
-
|
|
Apoptosis
|
Neurological Disease
|
|
Tat-NTS peptide is a cell-penetrating peptide with neuroprotective effects. Tat-NTS peptide can specifically inhibit the nuclear translocation of ANXA1 and reduce neuronal apoptosis in ischemic areas. Moreover, Tat-NTS peptide can reduce the volume of cerebral ischemic infarction and can be used in the research of ischemic stroke .
|
-
- HY-P0282
-
|
|
HIV
|
Infection
|
|
TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
- HY-P11117
-
|
|
TRP Channel
iGluR
Calcium Channel
|
Neurological Disease
|
|
TAT-EE3 is a neuroprotective peptide which can uncouple TRPM2-NMDARs interaction. TAT-EE3 inhibits TRPM2-induced enhancement of NMDAR surface expression and current amplitude.TAT-EE3 protects neurons against ischemic injury in vitro and in vivo. TAT-EE3can be used for the study of ischemic stroke .
|
-
- HY-P5381
-
-
- HY-P2193
-
|
|
Peptides
|
Infection
|
|
TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
|
-
- HY-P1491
-
|
|
HIV
|
Infection
|
|
HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
|
-
- HY-P1420
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P0281A
-
|
TAT(47-57) TFA; HIV-1 TAT protein (47-57) TFA
|
HIV
|
Infection
|
|
TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P4125A
-
|
|
HIV
Fluorescent Dye
|
Others
|
|
FITC-LC-TAT (47-57) acetate is a FITC-labeled TAT peptide (HY-P0281) (λex: 493 nm, λem: 522 nm). Derived from the trans-activator of transcription (TAT) of immunodeficiency virus (HIV-1), TAT enhances the yield of heterologous proteins .
|
-
- HY-P4122A
-
|
|
HIV
|
Others
|
|
TAT (47-57), FAM-labeled acetate is a 5(6)-Carboxyfluorescein (HY-15940)-labeled TAT (HY-P0281). TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide .
|
-
- HY-P4122
-
|
|
HIV
|
Others
|
|
TAT (47-57), FAM-labeled is a 5(6)-Carboxyfluorescein (HY-15940)-labeled TAT (HY-P0281). TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide .
|
-
- HY-P1328
-
TAT-14
1 Publications Verification
|
Keap1-Nrf2
|
Others
|
|
TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
- HY-P10446
-
|
|
Epigenetic Reader Domain
PROTACs
|
Cancer
|
|
TAT-PiET-PROTAC is a proteolysis-targeting chimera (PROTAC)-modified TAT-PiET (HY-P10445), which is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET-PROTAC can reduce BRD4 and JMJD6 levels and inhibit cell proliferation. TAT-PiET-PROTAC also resists the endocrine resistance of ERα-positive breast cancer cells. TAT-PiET-PROTAC can be used for the research of cancer, such as breast cancer .
|
-
- HY-P3432
-
|
|
Biochemical Assay Reagents
|
Others
|
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
-
- HY-P4113
-
|
|
Peptides
|
Neurological Disease
|
|
TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can readily permeate the cell membrane and interact with the intracellular organelle directly .
|
-
- HY-P1801A
-
|
Cys-[HIV-TAT (47-57)] TFA
|
HIV
Drug Derivative
|
Others
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) TFA, TAT (HY-P0281) derivative, is a Cysteine (HY-Y0337)-tagged cell-penetrating peptide (CPP) derived from the HIV TAT protein. Cys-TAT(47-57) TFA can be used for the research for the research of drug delivery .
|
-
- HY-P4123
-
|
|
MMP
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
TAT (47-57) GGG-Cys (Npys) is a cell-penetrating peptide and delivery carrier derived from TAT. TAT (47-57) GGG-Cys (Npys) facilitates the translocation of conjugated drug molecules across cell membranes. TAT (47-57) GGG-Cys (Npys) acts as a delivery carrier for MT1-MMP inhibitors. TAT (47-57) GGG-Cys (Npys) is applicable to research on diseases associated with MT1-MMP activity, such as cancer, arthritis, heart disease, and vascular disorders .
|
-
- HY-P10438
-
|
|
Raf
|
Cancer
|
|
TAT-Braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by TAT-Braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
|
-
- HY-P4056A
-
|
P15-TAT aceTATe
|
Casein Kinase
Apoptosis
|
Cancer
|
|
CIGB-300 acetate (P15-Tat acetate) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 acetate induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
- HY-P2500
-
|
|
Fluorescent Dye
|
Others
|
|
(Arg)9, FAM-labeled, a cell-penetrating peptide (CPP), is a nona-arginine (ARG) with FAM label. CPPs have emerged as powerful tools for delivering bioactive cargoes into the cytosol of intact cells .
|
-
- HY-P5405
-
|
Transducible TAT-HA fusogenic peptide
|
Peptides
|
Others
|
|
dTAT-HA2 enhances TAT-Cre escape from macropinosomes. dTAT-HA2 is a transfusible, pH-sensitive, fusogenic peptide .
|
-
- HY-P4125
-
|
|
HIV
Fluorescent Dye
|
Infection
|
|
FITC-LC-TAT (47-57) is a FITC-labeled TAT peptide (HY-P0281) (λex: 493 nm, λem: 522 nm). Derived from the trans-activator of transcription (TAT) of human immunodeficiency virus (HIV-1), TAT enhances the yield of heterologous proteins .
|
-
- HY-P1136C
-
-
- HY-P4056
-
|
P15-TAT
|
Casein Kinase
Apoptosis
|
Cancer
|
|
CIGB-300 (P15-Tat) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
- HY-P5118A
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
-
- HY-P3730
-
|
|
CDK
|
Cancer
|
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
-
- HY-P10839
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
NBD peptide inhibits NF-κB signaling pathway through inhibition of the NEMO-IKK complex combination. NBD peptide exhibits anti-inflammatory efficacy through block of pro-inflammatory cytokines production. NBD peptide exhibits immunosuppressive activity through regulation of immune cells. NBD peptide enhances its transmembrane ability by combining with cell-penetrating peptide HIV-TAT .
|
-
- HY-P10405A
-
|
|
Dopamine Receptor
|
Neurological Disease
|
|
TAT-D1 peptide acetate is a dopamine D1-D2 receptor heterodimer inhibitor. TAT-D1 peptide acetate disrupts the function of dopamine D1-D2 receptor heteromers, enhances subchronic amphetamine-induced locomotor activity, and exacerbates the expression of amphetamine-induced locomotor sensitization. TAT-D1 peptide acetate produces rapid anxiolytic and antidepressant-like effects in rat models of depression and anxiety, and inhibits c-fos expression in the nucleus accumbens of rats. TAT-D1 peptide acetate can be used in the research of psychostimulant addiction, depression and anxiety disorders .
|
-
- HY-P4101
-
|
|
HIV
|
Infection
|
|
Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1 .
|
-
- HY-P1801
-
|
Cys-[HIV-TAT (47-57)]
|
HIV
Drug Derivative
|
Others
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]), TAT (HY-P0281) derivative, is a Cysteine (HY-Y0337)-tagged cell-penetrating peptide (CPP) derived from the HIV TAT protein. Cys-TAT(47-57) can be used for the research for the research of drug delivery .
|
-
- HY-P10966A
-
|
|
IKK
NF-κB
|
Inflammation/Immunology
|
|
Tat-IKIP (46-60) TFA is the trifluoroacetic acid of Tat-IKIP (46-60) (HY-P10966). Tat-IKIP (46-60) is a IκB kinase (IKK)-targeting membrane-penetrating peptide. Tat-IKIP (46-60) inhibits IKK activation and NF-κB targeted gene expression by disrupting the IKKβ/NEMO complex. Tat-IKIP (46-60) significantly reduces DSS (HY-116282)-induced acute inflammation in inflammatory bowel disease (IBD) mice model and attenuates Zymosan-induced acute arthritis in acute arthritis model (AAM). Tat-IKIP (46-60) can be used for inflammatory diseases research, such as IBD, pancreatitis and rheumatoid arthritis .
|
-
- HY-P1575
-
|
|
HIV
|
Infection
|
|
TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
- HY-P4114
-
|
|
HIV
|
Others
|
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
-
- HY-P11219
-
|
|
YAP
|
Cancer
|
|
TAT-PDHPS1 is a YAP inhibitor composed of the endogenous peptide PDHPS1 and the cell-penetrating peptide sequence TAT. PDHPS1 binds to protein phosphatase 2 phosphatase activator (PTPA), an essential activator of protein phosphatase 2A (PP2A), leading to increased YAP phosphorylation, which inactivates YAP and suppresses the expression of its downstream target genes. TAT-PDHPS1 is potentially useful in ovarian cancer research .
|
-
- HY-P10638A
-
|
|
CaMK
|
Cardiovascular Disease
Neurological Disease
|
|
TAT-CN21 (scrambled) is a nonsense sequence control peptide fused with the TAT cell-penetrating sequence. It exerts no inhibitory effect on CaMKII activity and serves as a negative control for TatCN21 (HY-P10638) .
|
-
- HY-P10360
-
|
|
α-synuclein
|
Neurological Disease
|
|
Tat-βsyn-degron is an α-synuclein knockdown peptide that effectively degrades α-synuclein protein via the proteasome pathway. Tat-βsyn-degron effectively reduces α-synuclein protein levels in primary rat cortical neuron cultures. In a Parkinson's mouse toxicity model, Tat-βsyn-degron can alleviate parkinsonian toxin-induced neuronal damage and movement disorders .
|
-
- HY-P10358
-
|
|
Calcium Channel
|
Neurological Disease
|
|
TAT-CBD3A6K, is a modified TAT-CBD3 peptide. TAT-CBD3A6K reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function .
|
-
- HY-P3429
-
|
|
PKC
|
Cardiovascular Disease
|
|
SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
- HY-P4110
-
|
|
iGluR
|
Metabolic Disease
Inflammation/Immunology
|
|
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor .
|
-
- HY-P10405
-
|
|
Dopamine Receptor
|
Neurological Disease
|
|
TAT-D1 peptide is a dopamine D1-D2 receptor heterodimer inhibitor. TAT-D1 peptide disrupts the function of dopamine D1-D2 receptor heteromers, enhances subchronic amphetamine-induced locomotor activity, and exacerbates the expression of amphetamine-induced locomotor sensitization. TAT-D1 peptide produces rapid anxiolytic and antidepressant-like effects in rat models of depression and anxiety, and inhibits c-fos expression in the nucleus accumbens of rats. TAT-D1 peptide can be used in the research of psychostimulant addiction, depression and anxiety disorders .
|
-
- HY-P5307A
-
|
INF7-A5K-TAT aceTATe
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) acetate is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K acetate can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K acetate enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy .
|
-
- HY-P5320
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P11000
-
|
|
Biochemical Assay Reagents
|
Others
|
|
INF7TAT is an amphipathic peptide containing the influenza HA2 sequence and the TAT peptide (HY-P0281). INF7TAT can associate with other macromolecules through non-covalent associations. INF7TAT can be used for non-toxic delivery of siRNAs .
|
-
- HY-P0281B
-
|
TAT(47-57) aceTATe; HIV-1 TAT protein (47-57) aceTATe
|
HIV
|
Infection
|
|
TAT (TAT(47-57)) acetate is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT acetate can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P1575A
-
|
|
HIV
|
Infection
|
|
TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57 .
|
- HY-P11222
-
- HY-P4105
-
- HY-P5754
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
- HY-P10357
-
|
|
HIV
iGluR
|
Infection
Inflammation/Immunology
|
|
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .
|
- HY-P5118
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
- HY-P5119
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
|
- HY-P1420A
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
- HY-P10106
-
|
|
PAK
|
Cancer
|
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
- HY-P1908
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
- HY-P10797
-
- HY-P5320A
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
- HY-P10324
-
|
p16INK4a peptide
|
Peptides
|
Cancer
|
|
TAT-p16 (p16INK4a peptide) is a peptide mimic of p16INK4a that can induce an early G phase cell cycle arrest in the absence of active cyclin E:Cdk2 complex .
|
- HY-P10966
-
|
|
IKK
NF-κB
|
Inflammation/Immunology
|
|
Tat-IKIP (46-60) is a IκB kinase (IKK)-targeting membrane-penetrating peptide. Tat-IKIP (46-60) inhibits IKK activation and NF-κB targeted gene expression by disrupting the IKKβ/NEMO complex. Tat-IKIP (46-60) significantly reduces DSS (HY-116282)-induced acute inflammation in inflammatory bowel disease (IBD) mice model and attenuates Zymosan-induced acute arthritis in acute arthritis model (AAM). Tat-IKIP (46-60) can be used for inflammatory diseases research, such as IBD, pancreatitis and rheumatoid arthritis .
|
- HY-P5384
-
|
|
NADPH Oxidase
|
Others
|
|
sgp91 ds-tat is a biological active peptide. (This is a scrambled control peptide for gp91 ds-tat.)
|
- HY-P10465
-
|
|
TRP Channel
|
Inflammation/Immunology
|
|
TRPV1-Tat is an antagonistic peptide that fuses the TRPV1 (transient receptor potential vanilla subtype 1) of the cell-penetrating peptide Tat. TRPV1-Tat blocks this phosphorylation process by competitively binding to the AKAP79 binding site of TRPV1, thereby inhibiting the sensitization of TRPV1. TRPV1-Tat can be used in the study of inflammatory pain .
|
- HY-P11231
-
|
FUS(364-369)-TAT
|
Peptides
|
Cancer
|
|
β4-TAT is a kind of β-sheet peptide foldamer. β4-TAT is composed of two parts: the β4 sequence (derived from the β-sheet fragment of the RRM domain of fused in sarcoma (FUS)) and the TAT sequence (a nuclear localization signal peptide that helps the entire peptide penetrate the nuclear membrane). β4-TAT influences FUS aggregation by targeting its RNA recognition motifs (RRM). β4-TAT effectively induces FUS aggregation within cells, leading to the death of cancer cells. β4-TAT can be used for the study of FUS .
|
- HY-P5891
-
|
|
PKC
|
Cardiovascular Disease
|
|
TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
|
- HY-P4112
-
|
|
Peptides
|
Others
|
|
TAT-NSF222scr Fusion Polypeptide, scrambled is a control peptide of TAT-NSF700 Fusion Peptide (HY-P4113). TAT-NSF222scr Fusion Polypeptide, scrambled is consisted of the intact TAT domain followed by the amino acid residues of NSF 222-243 in a scrambled order .
|
- HY-P10074
-
|
|
ERK
|
Inflammation/Immunology
|
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
- HY-P5117
-
|
|
Toll-like Receptor (TLR)
|
Neurological Disease
|
|
TAT-CIRP is a a small peptide, refers to Trans-trans-activating (Tat)-cold-inducible RNA binding protein. TAT-CIRP is an inhibitor of myeloid differentiation protein 2 (MD2). TAT-CIRP exhibits robust neuroprotection against ischemic and hemorrhagic stroke in mice .
|
- HY-P10076
-
|
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
- HY-P4106A
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
- HY-P4106
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
- HY-P10107
-
|
|
Ras
|
Others
|
|
TAT-PAK18 R192A is an inactive Tat-Pak peptide. TAT-PAK18 R192A does not have any effect in the translocation of Rac1 triggered by any of the interrogated proteins .
|
- HY-P5281
-
- HY-P10995
-
|
|
EGFR
IFNAR
Interleukin Related
TNF Receptor
Complement System
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
TAT-327 is cell-penetrating peptide. TAT-327 selectively inserts into cancer cell membranes and shows potent antitumor activity. TAT-327 effectively inhibits cancer cells proliferation, induces apoptosis and disrupts EGFR signal pathway by inhibiting downstream signals (such as IL-2, TNF-α and IFN-γ) expression and the Eps8/EGFR interaction. TAT-327 significantly inhibits tumor growth in HT-29 xenograft mcie models .
|
- HY-P1328A
-
|
|
Keap1-Nrf2
|
Others
|
|
TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
- HY-P10445
-
|
|
Epigenetic Reader Domain
|
Cancer
|
|
TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET can reduce BRD4 and JMJD6 levels and inhibit cell proliferation. TAT-PiET also resists the endocrine resistance of ERα-positive breast cancer cells. TAT-PiET can be used for the research of cancer, such as breast cancer .
|
- HY-P11152
-
|
|
HIV
|
Infection
Inflammation/Immunology
|
|
HIV-1 tat Protein (1-9) occurs extracellularly and has a role in the immunosuppression of non-HIV-1-infected T cells in acquired AIDS. HIV-1 tat Protein (1-9) is an inhibitor of DP IV. HIV-1 tat Protein (1-9) can be synthesized by phase peptide synthesis with Fmoc (N-(9-fluorenyl)methoxycarbonyl) technique using the peptide synthesizer 431A. HIV-1 tat Protein (1-9) can be studied in research on HIV-1 .
|
- HY-P10852
-
- HY-P2193A
-
|
|
Peptides
|
Infection
|
|
TAT-amide TFA is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
|
- HY-P5277
-
|
|
DAPK
|
Neurological Disease
|
|
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
|
- HY-P2307
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
- HY-P2307A
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
- HY-P10821
-
- HY-P5754A
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
- HY-P4103
-
- HY-P10358A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
TAT-CBD3A6K acetate, is a modified TAT-CBD3 peptide. TAT-CBD3A6K acetate reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K acetate shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function .
|
- HY-P10110
-
|
|
Autophagy
|
Neurological Disease
|
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
- HY-P2298
-
|
|
PKC
|
Neurological Disease
|
|
TAT-P4-(DATC5)2 is a high-affinity peptide inhibitor of the PICK1 (protein interacting with C kinase-1) PDZ domain, with a Ki of 1.7 nM. TAT-P4-(DATC5)2 can inhibit addiction in rats .
|
- HY-P2298A
-
|
|
PKC
|
Neurological Disease
|
|
TAT-P4-(DATC5)2 TFA is a high-affinity peptide inhibitor of the PICK1 (protein interacting with C kinase-1) PDZ domain, with a Ki of 1.7 nM. TAT-P4-(DATC5)2 TFA can inhibit addiction in rats .
|
- HY-P5119A
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
|
- HY-P10464
-
|
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
- HY-P10977
-
|
|
Sodium Channel
RIP kinase
|
Neurological Disease
|
|
Tat-ASIC1a (1-20) (mouse, rat) is a competitive ASIC1a membrane-penetrating peptide. Tat-ASIC1a (1-20) (mouse, rat) has significantly neuroprotection effects, and reduces neuronal damage against acidotoxicity by targeting the ASIC1a-RIPK1 pathway and auto-inhibitory mechanism. Tat-ASIC1a (1-20) (mouse, rat) effectively protects brains from ischemic injury in ischemic stroke mice model. Tat-ASIC1a (1-20) (mouse, rat) can be used for neurodegenerative diseases research, such as Huntington disease and Parkinson’s disease .
|
- HY-P0281F
-
|
Cy5-TAT(47-57) aceTATe; Cy5-HIV-1 TAT protein (47-57) aceTATe
|
Fluorescent Dye
|
Others
|
|
Cy5-TAT acetate is a TAT peptide labeled with CY5 (HY-D0821) (Ex= 600-620 nm, Em= 670 nm). Cy5-TAT acetate can be used for fluorescence microscopy especially single-molecule fluorescence imaging .
|
- HY-P10357A
-
|
|
HIV
iGluR
|
Infection
Inflammation/Immunology
|
|
Tat-CBD3 TFA, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .
|
- HY-P3730A
-
|
|
CDK
|
Cancer
|
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG) acetate, a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
- HY-P2260
-
Tat-beclin 1
Maximum Cited Publications
6 Publications Verification
|
CHIKV
Autophagy
HIV
|
Infection
|
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
- HY-P2260A
-
|
|
Autophagy
HIV
|
Infection
|
|
Tat-beclin 1 TFA, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 TFA decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
- HY-P2280
-
- HY-P2259
-
|
|
iGluR
HIV Integrase
Adenosine Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
TAT-GluA2 3Y is a blood-brain barrier-permeable AMPA receptor inhibitory peptide that crosses cell membranes via the HIV-1 TAT protein domain. TAT-GluA2 3Y blocks the endocytosis of AMPA receptors, including the internalization of GluA1/GluA2 subunits, by disrupting interactions with the AP2, Brag2 and Syt3-GluA2 complexes, while also inhibiting long-term depression. TAT-GluA2 3Y blocks hypoxia-mediated AMPAR internalization, alleviates A1R-induced persistent synaptic inhibition, and reduces cerebral ischemic volume, neurological deficits and spatial memory deficits. TAT-GluA2 3Y blocks the effect of NLRP3 deficiency on fear generalization, inhibits amphetamine-induced behavioral/neurochemical sensitization, weakens the unconditioned stimulus-conditioned stimulus association of morphine, and promotes the extinction of morphine CPP. TAT-GluA2 3Y can be used in studies related to fear generalization, ischemic stroke, hypoxia, drug addiction and opioid addiction .
|
- HY-P10359A
-
|
|
TGF-beta/Smad
MMP
|
Neurological Disease
|
|
TAT-QFNP12 acetate is a peptide that blocks the NDRG2-PPM1A binding and reduces Smad2/3 phosphorylation, decreases astrocytic MMP-9 production and BBB disruption after subarachnoid hemorrhage (SAH) .
|
- HY-P10359
-
|
|
TGF-beta/Smad
MMP
|
Neurological Disease
|
|
TAT-QFNP12 is a peptide that blocks the NDRG2-PPM1A binding and reduces Smad2/3 phosphorylation, decreases astrocytic MMP-9 production and BBB disruption after subarachnoid hemorrhage (SAH) .
|
- HY-P5107A
-
|
LMWP aceTATe; TDSP5 aceTATe
|
VEGFR
|
Cancer
|
|
Low molecular weight protamine acetate (LMWP acetate;TDSP5 acetate) is a truncated arginine-rich protamine peptide, which also acts as an antidote for heparin/low molecular weight heparin and a cell-penetrating delivery vector. Low molecular weight protamine acetate neutralizes heparin-induced anticoagulant activities, including aPTT, anti-Xa and anti-IIa activities. Low molecular weight protamine acetate translocates across mammalian cell membranes, delivers conjugated impermeable molecules through tumor tissues, enhances the skin permeability of conjugated epidermal growth factor, and accelerates wound healing when conjugated with epidermal growth factor. Low molecular weight protamine acetate retains the in vitro cell proliferation activity of conjugated EGF, and also enables site-specific conjugation with peptides or proteins via genetic recombination. Low molecular weight protamine acetate can be used in studies related to colon cancer, skin wounds and diabetic skin wounds .
|
| Cat. No. |
상품명 |
Category |
Target |
Chemical Structure |
| Cat. No. |
상품명 |
Chemical Structure |
-
- HY-P10324
-
|
|
|
TAT-p16 (p16INK4a peptide) is a peptide mimic of p16INK4a that can induce an early G phase cell cycle arrest in the absence of active cyclin E:Cdk2 complex .
|
-
| Cat. No. |
상품명 |
|
Classification |
-
- HY-172279A
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG2000-TAT is a cell-penetrating peptide-modified PEGylated phospholipid conjugate and cellular uptake enhancer. DSPE-PEG2000-TAT forms via conjugation of Cys-TAT to DSPE-PEG2000-Mal. DSPE-PEG2000-TAT enhances liposomal cellular uptake and siRNA transfection efficiency in glomerular mesangial and macrophage cells. DSPE-PEG2000-TAT can be used for drug delivery .
|
-
- HY-172279
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG1000-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG1000-TAT can be used for drug delivery .
|
-
- HY-172279C
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG3400-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG3400-TAT can be used for drug delivery .
|
-
- HY-172279B
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG5000-TAT is a PEG compound which composed of DSPE and a cell-penetrating peptide (TAT) (HY-P0281). DSPE-PEG5000-TAT can be used for drug delivery .
|
Your information is safe with us. * Required Fields.
Inquiry Information
- 상품명:
- Cat. No.:
- 수량:
- MCE Japan Authorized Agent: