Peptide A5K acetate
Peptide A5K (INF7-A5K-TAT) acetate is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K acetate can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K acetate enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy.
For research use only. We do not sell to patients.
- Formula: C182H275N55O48S.xC2H4O2
- Molecular Weight:4033.54 (free acid)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Peptide A5K acetate effectively edits T cells without substantial impact on T cell viability[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 4033.54 (free acid)
-
Formula C182H275N55O48S.xC2H4O2
-
Synonyms
INF7-A5K-TAT acetate
-
Sequence
Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Peptide A5K acetate Related Classifications
HY-P5307A Related Classifications
Powered by Bioz