Peptide A5K
Based on 1 Customer Validation
Peptide A5K (INF7-A5K-TAT) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit : 99.34%
- Formel: C182H275N55O48S
- Molecular Weight:4033.54
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
Beschreibung
In Vitro
Peptide A5K effectively edits T cells without substantial impact on T cell viability[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4033.54
-
Formel C182H275N55O48S
-
Color White to off-white
-
Synonyms
INF7-A5K-TAT
-
Sequence
Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
In Vitro:
H2O : ≥ 100 mg/mL (24.79 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Protokoll
-
Gene Editing
Gene editing modify specific sites within the genome through gene deletions, insertions or conversions to study functionally unknown genes or conduct gene therapy. It is also used to change the biological traits of organisms to establish new varieties. Gene editing techniques include zinc finger nuclease (ZFN), transcription activator-like effector nuclease (TALEN), and clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated protein 9 (Cas 9) (CRISPR/Cas9).
-
CRISPR-Cas9 knockout in cultured mammalian cells
CRISPR-Cas9 knockout in cultured mammalian cells uses an sgRNA to direct Cas9 to a complementary genomic sequence adjacent to a compatible PAM; Cas9 creates a targeted DNA double-strand break, and repair by non-homologous end joining can introduce insertions or deletions that disrupt the coding sequence or functional genomic element. The readout of knockout is detection of edited alleles and loss of gene product or phenotype, commonly by PCR/Sanger-sequence trace decomposition, targeted sequencing, immunoblotting, immunostaining, or flow cytometry when the target protein is detectable at the cell surface.
-
CRISPR/Cas9 Knockout Animal Model
CRISPR/Cas9 knockout animal modeling uses guide RNA to direct Cas9 to a genomic target, where Cas9 creates a DNA double-strand break; repair by error-prone non-homologous end joining generates insertions or deletions that can disrupt coding sequence and produce knockout alleles. Classic animal-model workflows deliver Cas9 mRNA or Cas9 protein with sgRNA into fertilized zygotes by microinjection or electroporation, then transfer edited embryos into pseudopregnant recipients and genotype founders for target-site mutations.
Reinheit & Dokumentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2479 mL | 1.2396 mL | 2.4792 mL | 6.1980 mL |
| 5 mM | 0.0496 mL | 0.2479 mL | 0.4958 mL | 1.2396 mL | |
| 10 mM | 0.0248 mL | 0.1240 mL | 0.2479 mL | 0.6198 mL | |
| 15 mM | 0.0165 mL | 0.0826 mL | 0.1653 mL | 0.4132 mL | |
| 20 mM | 0.0124 mL | 0.0620 mL | 0.1240 mL | 0.3099 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.