TAT-CN21 (scrambled)
Based on 1 Customer Validation
TAT-CN21 (scrambled) is a nonsense sequence control peptide fused with the TAT cell-penetrating sequence. It exerts no inhibitory effect on CaMKII activity and serves as a negative control for TatCN21 (HY-P10638).
For research use only. We do not sell to patients.
- Purity: 99.71%
- Formula: C169H303N69O43
- Molecular Weight:3989.65
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
IC50 & Target
|
CaMK II |
In Vitro
TAT-CN21 (scrambled) is a nonsense sequence control peptide fused with the TAT cell-penetrating sequence. It exhibits no inhibitory effect on CaMKII activity and serves as a negative control for TatCN21 (HY-P10638).
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3989.65
-
Formula C169H303N69O43
-
Color White to off-white
-
Sequence
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Val-Lys-Glu-Pro-Arg-Ile-Asp-Gly-Lys-Pro-Val-Arg-Leu-Arg-Gly-Gln-Lys-Ser-Asp-Arg-Ile
-
Sequence Shortening
YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : 100 mg/mL (25.06 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (283 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Buard I, et al. CaMKII "autonomy" is required for initiating but not for maintaining neuronal long-term information storage. J Neurosci. 2010;30(24):8214-8220. [Content Brief]
[2]. Tao-Cheng JH, et al. Effects of CaMKII inhibitor tatCN21 on activity-dependent redistribution of CaMKII in hippocampal neurons. Neuroscience. 2013;244:188-196. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2506 mL | 1.2532 mL | 2.5065 mL | 6.2662 mL |
| 5 mM | 0.0501 mL | 0.2506 mL | 0.5013 mL | 1.2532 mL | |
| 10 mM | 0.0251 mL | 0.1253 mL | 0.2506 mL | 0.6266 mL | |
| 15 mM | 0.0167 mL | 0.0835 mL | 0.1671 mL | 0.4177 mL | |
| 20 mM | 0.0125 mL | 0.0627 mL | 0.1253 mL | 0.3133 mL | |
| 25 mM | 0.0100 mL | 0.0501 mL | 0.1003 mL | 0.2506 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.